Herbidospora_cretacea_NRRL_B-16917 - 37 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JODQ01000001.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T1PKS,arylpolyene	14,963	125,110	Low	butyrolactol A	PKS
Region 1.2	terpene-precursor	397,784	418,887
Region 1.3	terpene	550,512	571,417
Region 1.4	NRPS	862,904	907,958

JODQ01000002.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-v,lanthipeptide-class-ii	94,013	136,093

JODQ01000003.1 (Herbidospora cretacea)

Region	Type	From	To
Region 3.1	NI-siderophore	10,125	41,186
Region 3.2	RiPP-like	163,349	174,170
Region 3.3	terpene	374,366	396,653

JODQ01000004.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	hydrogen-cyanide	59,230	71,783	Low	aborycin	ribosomal:RiPP
Region 4.2	T3PKS	100,729	141,772	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 4.3	lanthipeptide-class-v	214,212	257,509	Low	isorenieratene	terpene

JODQ01000006.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	terpene	40,941	62,884	Low	2-methylisoborneol	terpene:Monoterpene
Region 6.2	NRPS,T1PKS	199,452	307,610
Region 6.3	NRP-metallophore,NRPS,terpene,NRPS-like	510,558	631,653	High	scabichelin	NRPS:Type I
Region 6.4	terpene-precursor	643,627	664,661
Region 6.5	terpene	696,550	719,015
Region 6.6	NRPS,T1PKS	844,423	894,841

JODQ01000007.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NRPS	68,658	120,428
Region 7.2	T1PKS	210,314	281,388	Medium	abyssomicin C/atrop-abyssomicin C	PKS:Type I
Region 7.3	2dos	464,818	494,032
Region 7.4	lanthipeptide-class-iii,RRE-containing	580,280	610,574	Low	labyrinthopeptin A2/labyrinthopeptin A1/labyrinthopeptin A3	ribosomal:RiPP:Lanthipeptide
Region 7.5	terpene	700,244	721,347
Region 7.6	NRPS,lassopeptide	721,979	772,769
Region 7.7	T1PKS,PKS-like	1,048,569	1,094,679

JODQ01000008.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	azole-containing-RiPP,thioamitides	108,931	137,179
Region 8.2	terpene,lanthipeptide-class-ii,azole-containing-RiPP	170,314	211,376	Low	2-methylisoborneol	terpene:Monoterpene

JODQ01000009.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	azole-containing-RiPP,RRE-containing	207,724	236,624

JODQ01000010.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	thioamitides	35,354	60,217
Region 10.2	NRPS	146,560	222,040	Low	enduracidin A/enduracidin B	NRPS:Type I

JODQ01000013.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	RiPP-like	84,184	94,984
Region 13.2	NRPS	107,662	162,853

JODQ01000014.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	terpene-precursor	177,640	198,560

JODQ01000015.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	benzoxazole,NRPS-like,azole-containing-RiPP	248,257	313,161	High	caboxamycin	other:shikimate-derived

JODQ01000017.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	T3PKS,NRPS	1	32,396	Low	feglymycin	NRPS:Type I

JODQ01000018.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	lanthipeptide-class-iii	4,205	26,715	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide

JODQ01000021.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NRPS	1	15,778

JODQ01000024.1 (Herbidospora cretacea)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NRPS	1	1,840	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I

No secondary metabolite regions were found in these records:: JODQ01000005.1 (Herbidospora cretacea); JODQ01000011.1 (Herbidospora cretacea); JODQ01000012.1 (Herbidospora cretacea); JODQ01000016.1 (Herbidospora cretacea); JODQ01000019.1 (Herbidospora cretacea); JODQ01000020.1 (Herbidospora cretacea); JODQ01000022.1 (Herbidospora cretacea); JODQ01000023.1 (Herbidospora cretacea); JODQ01000025.1 (Herbidospora cretacea); JODQ01000026.1 (Herbidospora cretacea); JODQ01000027.1 (Herbidospora cretacea)

Compact view

JODQ01000001.1 - Region 1 - T1PKS,arylpolyene

Download region GenBank file

Download region SVG

Location: 14,963 - 125,110 nt. (total: 110,148 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg1_32: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg1_36: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg1_38: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

ctg1_63: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg1_69: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg1_70: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg1_72: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: PPTase acylase aminotransferase transferase

ctg1_16: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg1_33: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

ctg1_41: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg1_51: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

ctg1_61: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg1_78: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: dehalogenase esterase hydrolase phosphatase

ctg1_34: thioesterase

smcogs: SMCOG1004: thioesterase

ctg1_35: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

ctg1_58: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

ctg1_62: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase dehydratase

ctg1_15: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg1_46: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

ctg1_30: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

ctg1_31: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_39: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_40: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_42: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_43: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg1_45: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg1_47: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg1_49: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg1_65: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

ctg1_76: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.58	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.65	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.65 out of 26.85

Confidence: medium

Additional weak hits (19):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.29 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.73 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.33 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.05 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.94 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.94 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.97 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 14962 - 125110:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - pk) + (Me-ccmal) + (ohmal) + (ohmal) + (ccmal) + (ccmal - ohmal)
Non-colinear ordering:: ctg1_43 + ctg1_41 + ctg1_40 + ctg1_30 + ctg1_42 + ctg1_39

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 14962 - 102407:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - pk) + (Me-ccmal) + (ohmal) + (ohmal) + (ccmal) + (ccmal - ohmal)
Non-colinear ordering:: ctg1_43 + ctg1_41 + ctg1_40 + ctg1_30 + ctg1_42 + ctg1_39

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg1_30: mal

PKS_AT (540..840): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.3
inactive: 57.0
Methoxymalonyl-CoA: 53.6
Methylmalonyl-CoA: 37.3
Propionyl-CoA: 22.9
Isobutyryl-CoA: 19.6
Ethylmalonyl-CoA: 19.6
Benzoyl-CoA: 16.8
fatty_acid: 13.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_39: mal - mal

PKS_AT (533..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.1
inactive: 63.7
Methoxymalonyl-CoA: 46.5
Methylmalonyl-CoA: 38.5
Isobutyryl-CoA: 18.0
Propionyl-CoA: 14.2
Ethylmalonyl-CoA: 13.7
Acetyl-CoA: 10.0
3-Methylbutyryl-CoA: 9.9
Benzoyl-CoA: 8.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2023..2323): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 133.6
inactive: 78.4
Methoxymalonyl-CoA: 60.3
Methylmalonyl-CoA: 45.3
Propionyl-CoA: 31.8
Isobutyryl-CoA: 16.3
2-Methylbutyryl-CoA: 12.3
CHC-CoA: 9.7
Benzoyl-CoA: 9.6
Ethylmalonyl-CoA: 9.3
Acetyl-CoA: 7.9
3-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

ctg1_40: mal

PKS_AT (559..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.3
inactive: 63.2
Methoxymalonyl-CoA: 49.1
Methylmalonyl-CoA: 43.0
Propionyl-CoA: 23.2
2-Methylbutyryl-CoA: 11.4
fatty_acid: 9.5
Isobutyryl-CoA: 8.2
Benzoyl-CoA: 8.1
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg1_41: mmal

PKS_AT (563..858): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 179.0
Ethylmalonyl-CoA: 166.0
Methoxymalonyl-CoA: 144.8
trans-1,2-CPDA: 105.4
2-Methylbutyryl-CoA: 94.0
Propionyl-CoA: 85.8
Malonyl-CoA: 73.3
CHC-CoA: 65.7
Benzoyl-CoA: 50.5
Isobutyryl-CoA: 40.0
3-Methylbutyryl-CoA: 25.1
Acetyl-CoA: 23.8
inactive: 22.2
fatty_acid: 17.5

ctg1_42: mal

PKS_AT (561..851): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.5
inactive: 86.6
Methoxymalonyl-CoA: 59.7
Methylmalonyl-CoA: 39.8
Acetyl-CoA: 24.4
Ethylmalonyl-CoA: 24.2
Isobutyryl-CoA: 21.7
Benzoyl-CoA: 16.9
CHC-CoA: 15.5
trans-1,2-CPDA: 11.7
fatty_acid: 9.0
Propionyl-CoA: 8.7
2-Methylbutyryl-CoA: 5.5
3-Methylbutyryl-CoA: 0.0

ctg1_43: mmal - pk

PKS_AT (526..823): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 185.6
Ethylmalonyl-CoA: 162.1
Methoxymalonyl-CoA: 153.5
trans-1,2-CPDA: 133.0
2-Methylbutyryl-CoA: 128.0
Propionyl-CoA: 112.0
Malonyl-CoA: 102.4
CHC-CoA: 90.8
Acetyl-CoA: 52.4
Isobutyryl-CoA: 51.6
Benzoyl-CoA: 35.9
3-Methylbutyryl-CoA: 34.4
fatty_acid: 25.6
inactive: 22.6

PKS_AT (1505..1797): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 172.6
Methylmalonyl-CoA: 172.2
Methoxymalonyl-CoA: 148.6
2-Methylbutyryl-CoA: 108.4
trans-1,2-CPDA: 95.8
Propionyl-CoA: 90.6
Malonyl-CoA: 86.0
CHC-CoA: 66.6
Benzoyl-CoA: 52.1
Isobutyryl-CoA: 48.2
Acetyl-CoA: 35.4
inactive: 25.6
3-Methylbutyryl-CoA: 24.0
fatty_acid: 20.3

ctg1_47: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (14..391): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTATMFRK
Nearest Stachelhaus code(s):: Asp DASTATMFRK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg1_61: mal

PKS_AT (4..278): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 67.5
Methoxymalonyl-CoA: 32.5
inactive: 31.6
fatty_acid: 26.2
Methylmalonyl-CoA: 23.8
Isobutyryl-CoA: 21.5
Benzoyl-CoA: 19.5
Acetyl-CoA: 14.0
Propionyl-CoA: 11.7
Ethylmalonyl-CoA: 11.7
2-Methylbutyryl-CoA: 3.6
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000001.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 397,784 - 418,887 nt. (total: 21,104 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg1_359: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

ctg1_360: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

ctg1_357: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Ligases: synthetase

ctg1_356: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg1_356: PT_FPPS_like

Domain 1 (59 - 360): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.64 out of 24.78

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.56 out of 29.65

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.06 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.27 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.82 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.73 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.63 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

JODQ01000001.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 550,512 - 571,417 nt. (total: 20,906 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

ctg1_499: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001374.5	0.31	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001810.3	0.31	PKS	trehangelin	Polymorphospora rubra

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001374.5	0.31	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001810.3	0.31	PKS	trehangelin	Polymorphospora rubra

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg1_499: T1TS

Domain 1 (63 - 300): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 26.87 out of 35.63

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.97 out of 30.97

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.05 out of 27.18

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.69 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.23 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
NrtR	NAD synthesis repressor

JODQ01000001.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 862,904 - 907,958 nt. (total: 45,055 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg1_784: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg1_789: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase synthase

ctg1_792: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

ctg1_794: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg1_795: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg1_796: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg1_798: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

ctg1_802: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (16):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.16 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.07 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.61 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.51 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.76 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.73 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.26 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 862903 - 907958:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg1_795: X

AMP-binding (8..369): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PINFGAYPAK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg1_796: X

AMP-binding (443..807): X

nrpys: Asn, Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFTKIGHVGK
Nearest Stachelhaus code(s):: Asn DFTKIGEVGK (62% 8Å match); Asp DLTKIGHVGK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000002.1 - Region 1 - lanthipeptide-class-ii,lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 94,013 - 136,093 nt. (total: 42,081 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

ctg2_81: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg2_88: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

ctg2_93: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

ctg2_113: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

ctg2_104: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.40	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002703.2	0.35	ribosomal	archalan α	Halorussus salinus
BGC0000516.4	0.32	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002704.2	0.32	ribosomal	archalan β	Halorussus salinus
BGC0001210.5	0.32	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000504.5	0.31	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001229.4	0.31	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002303.3	0.31	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000500.5	0.31	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.5	0.31	ribosomal	bicereucin	Bacillus cereus SJ1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.53	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000516.4	0.49	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001210.5	0.47	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002303.3	0.47	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001229.4	0.46	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001407.5	0.46	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.46	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg2_104

allorf_116092_116217

Leader:

MRRNLWTRKGSATSQEFTGSRHMAVAWQILAG

allorf_116092_116217

Leader:

MRRNLWTRKGSATSQEFTGSRHMAVAWQILAG

Shared core:

RCSRMAEGR

Core with dehydrations:

RCysDhaRMAEGR

antiSMASH-DB 4.0 matches for allorf_116092_116217

22.2%

NZ_LMEI01000006.1:

Lanthipeptides: allorf_385739_385885_lanthipeptide

2

CSRMAEGR

9

C R AEGR

3

CDRKAEGR

10

allorf_131296_131397

Leader:

MGLADDGESSRPSMVVTQLESPMGA

allorf_131296_131397

Leader:

MGLADDGESSRPSMVVTQLESPMGA

Shared core:

GCSSNSWR

Core with dehydrations:

GCysDhaDhaNDhaWR

antiSMASH-DB 4.0 matches for allorf_131296_131397

100.0%

NZ_BBXE01000013.1and 3 others:

NZ_BBXE01000013.1 Lanthipeptides: allorf_324696_324821_lanthipeptideNZ_WXEW01000006.1 Lanthipeptides: allorf_323710_323835_lanthipeptideNZ_WXEW01000006.1 Lanthipeptides: allorf_323710_323835_lanthipeptide

Lanthipeptides: allorf_324696_324821_lanthipeptide

1

GCSSNSWR

8

GCSSNSWR

1

GCSSNSWR

8

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.72 out of 26.85

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.92 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.00 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.68 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_116092_116217 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 1046.5 Da

Molecular weight: 1047.2 Da

Number of bridges: 1

allorf_131296_131397 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 841.4 Da

Molecular weight: 841.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 859.9 Da N = 1; 877.9 Da N = 2

allorf_116092_116217 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 1046.5 Da

Molecular weight: 1047.2 Da

Number of bridges: 1

allorf_131296_131397 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 841.4 Da

Molecular weight: 841.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 859.9 Da N = 1; 877.9 Da N = 2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

JODQ01000003.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 10,125 - 41,186 nt. (total: 31,062 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

ctg3_14: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase protease

ctg3_19: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

ctg3_35: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

ctg3_28: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002681.3	0.46	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0000943.5	0.41	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002466.3	0.38	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002681.3	0.46	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4
BGC0000943.5	0.41	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002466.3	0.38	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.72 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.86 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.18 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.63 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 36.53

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor

JODQ01000003.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 163,349 - 174,170 nt. (total: 10,822 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.61 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.15 out of 27.04

Confidence: medium

Additional weak hits (11):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.95 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.36 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.42 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.23 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.43 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.74 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000003.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 374,366 - 396,653 nt. (total: 22,288 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

ctg3_371: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

ctg3_378: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

ctg3_386: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: methyltransferase

ctg3_368: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: hydratase

ctg3_370: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

ctg3_369: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.52	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000674.5	0.51	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001910.4	0.51	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.51	terpene	raimonol	Streptomyces anulatus
BGC0000913.3	0.46	other (other)	MK-8	Enterobacter cloacae
BGC0000286.3	0.46	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000671.3	0.43	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002221.2	0.43	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.52	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000674.5	0.51	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001910.4	0.51	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.51	terpene	raimonol	Streptomyces anulatus
BGC0000913.3	0.46	other (other)	MK-8	Enterobacter cloacae
BGC0000286.3	0.46	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000671.3	0.43	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002221.2	0.43	terpene	ent-kauren-16alpha-ol	Serpula lacrymans var. lacrymans S7.9

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

ctg3_376: T2TS

Domain 1 (2 - 487): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 32.93

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.71 out of 25.31

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.24 out of 32.93

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

JODQ01000004.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 59,230 - 71,783 nt. (total: 12,554 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

ctg4_59: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

ctg4_61: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001013.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp.
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001872.3	0.26	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001056.5	0.23	NRPS, PKS	zeamine, zeamine I, zeamine II, prezeamine, prezeamine I	Serratia plymuthica RVH1
BGC0001011.5	0.22	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0002101.3	0.22	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406
BGC0000029.5	0.22	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001013.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp.
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001872.3	0.26	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001056.5	0.23	NRPS, PKS	zeamine, zeamine I, zeamine II, prezeamine, prezeamine I	Serratia plymuthica RVH1
BGC0001011.5	0.22	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0002101.3	0.22	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406
BGC0000029.5	0.22	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.85 out of 23.43

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.26 out of 23.79

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000004.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 100,729 - 141,772 nt. (total: 41,044 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg4_100: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg4_112: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

ctg4_124: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg4_125: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg4_128: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase methyltransferase

ctg4_111: methyltransferase

smcogs: SMCOG1248: methyltransferase

ctg4_113: Methylation

MITE: MITE0000155Methylation (identity: 74.60%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

ctg4_95: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

ctg4_102: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: mutase

ctg4_130: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

ctg4_114: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

ctg4_97: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.75	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.55	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000917.3	0.49	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001077.4	0.45	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.75	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.55	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000917.3	0.49	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001077.4	0.45	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.04 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (12):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.88 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.00 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.38 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.26 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.75 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.62 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.46 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg4_97: X

AMP-binding (22..476): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IALFMAALLK
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (26% 8Å match); Leu DALFMGAVAK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

JODQ01000004.1 - Region 3 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 214,212 - 257,509 nt. (total: 43,298 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg4_225: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: methyltransferase

ctg4_226: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: peptidase

ctg4_230: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase

ctg4_220: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

ctg4_236: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

ctg4_237: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni
BGC0001289.5	0.42	ribosomal	penisin	Paenibacillus ehimensis
BGC0001223.5	0.42	other (other)	hydroxysporine	uncultured bacterium
BGC0000517.4	0.42	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000572.5	0.41	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002303.3	0.41	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni
BGC0001289.5	0.42	ribosomal	penisin	Paenibacillus ehimensis
BGC0001223.5	0.42	other (other)	hydroxysporine	uncultured bacterium
BGC0000517.4	0.42	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000572.5	0.41	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002303.3	0.41	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.70 out of 27.04

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

Additional weak hits (15):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.99 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.00 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.40 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.19 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.72 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor

JODQ01000006.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 40,941 - 62,884 nt. (total: 21,944 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

ctg6_41: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Lyases: cyclase

ctg6_47: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.77	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.57	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000495.5	0.31	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0002294.3	0.27	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002656.2	0.27	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002666.2	0.27	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000804.5	0.24	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0000268.5	0.24	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.77	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.57	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000495.5	0.31	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001553.5	0.27	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0002294.3	0.27	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002656.2	0.27	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002666.2	0.27	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000804.5	0.24	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0000268.5	0.24	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

ctg6_47: T1TS + T1TS

Domain 1 (2 - 324): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (342 - 623): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.29 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

JODQ01000006.1 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 199,452 - 307,610 nt. (total: 108,159 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg6_178: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

ctg6_192: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

ctg6_196: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg6_200: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg6_207: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: glycosyltransferase

ctg6_188: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

ctg6_191: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

ctg6_219: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase protease

ctg6_226: putative esterase

smcogs: SMCOG1104: putative esterase

ctg6_244: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

ctg6_217: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

ctg6_218: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

ctg6_186: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

ctg6_190: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg6_193: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg6_199: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

ctg6_224: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

ctg6_227: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg6_228: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg6_229: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

ctg6_206: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	1.26	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	1.10	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.08	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.07	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.07	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	1.05	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	1.03	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.03	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.97	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.96	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.84 out of 23.79

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

Additional weak hits (30):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.24 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.16 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.50 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.99 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.32 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.02 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.35 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.81 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.37 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.50 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.44 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.43 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.12 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.23 out of 26.06

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.29 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 199451 - 307610:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (X - X) + (Me-ccmal) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 199451 - 244782:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 218538 - 263590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 256435 - 307610:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_190: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (503..885): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLPKVAEVGK
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg6_193: X

AMP-binding (39..465): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GGNLFASPAK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg6_199: mmal

PKS_AT (533..828): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.0
Methoxymalonyl-CoA: 102.1
Ethylmalonyl-CoA: 101.3
Malonyl-CoA: 85.6
trans-1,2-CPDA: 74.7
2-Methylbutyryl-CoA: 57.3
Propionyl-CoA: 52.0
Isobutyryl-CoA: 47.1
fatty_acid: 42.5
Acetyl-CoA: 36.7
CHC-CoA: 34.4
inactive: 20.9
Benzoyl-CoA: 15.7
3-Methylbutyryl-CoA: 13.7

ctg6_228: X - X

AMP-binding (436..786): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIVQIAGIYK
Nearest Stachelhaus code(s):: Ala DILQIGQIYK (79% 8Å match); Aol DIWFVAGIYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1405..1746): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEDIGTIIK
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg6_229: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (467..842): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DFTKLGHVGK
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (74% 8Å match); Asn DLTKLGEVGK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

JODQ01000006.1 - Region 3 - NRP-metallophore,NRPS,NRPS-like,terpene

Download region GenBank file

Download region SVG

Location: 510,558 - 631,653 nt. (total: 121,096 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

ctg6_429: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

ctg6_440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg6_477: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg6_483: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg6_484: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg6_498: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: formyltransferase methyltransferase

ctg6_430: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

ctg6_437: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: back translocase dehalogenase glucosidase hydrolase

ctg6_449: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

ctg6_457: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

ctg6_472: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

ctg6_473: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

ctg6_488: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

ctg6_463: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

ctg6_478: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

ctg6_479: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg6_481: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	1.53	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	1.52	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.47	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.44	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	1.39	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.37	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	1.37	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.35	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000423.5	0.76	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

ctg6_463: T1TS + T1TS

Domain 1 (1 - 321): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (331 - 680): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.55 out of 23.43

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (39):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.16 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.31 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.24 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.18 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.75 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.29 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.98 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.21 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.89 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.32 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.19 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.84 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.05 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.83 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.05 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.10 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.94 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.03 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 510557 - 599093:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - Ser - NMe-OH-Orn - Orn - Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 510557 - 579269:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - Ser - NMe-OH-Orn - Orn - Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 585106 - 631653:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Glu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 585106 - 628163:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Glu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 588359 - 631653:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_437: Fo-OH-Orn - Ser - OH-Orn - Orn - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (192..582): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWILGATNK
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1564..1959): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2581..2976): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DMENLGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3931..4293): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGEDSGLVDK
Nearest Stachelhaus code(s):: Orn DGEDAGLVDK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4893..5261): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLVDK
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5853..6224): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQEGGLVDK
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg6_479: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (36..441): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: DSWDLGTIGK
Nearest Stachelhaus code(s):: Glu DVWHVGSIGK (53% 8Å match); Asp DSWKLGVVDK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg6_481: X

AMP-binding (499..890): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVSDFGGVTK
Nearest Stachelhaus code(s):: dn-dohHep DVFDFGGVTK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000006.1 - Region 4 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 643,627 - 664,661 nt. (total: 21,035 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg6_519: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Ligases: ligase synthetase

ctg6_523: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

ctg6_528: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000850.5	0.43	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000850.5	0.43	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg6_523: PT_FPPS_like

Domain 1 (53 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

Additional weak hits (18):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.77 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.03 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.90 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.04 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.11 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.33 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.56 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.30 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.94 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.51 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.33 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.47 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000006.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 696,550 - 719,015 nt. (total: 22,466 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg6_579: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: peptidase

ctg6_566: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000875.4	0.34	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0001367.5	0.34	NRPS, PKS	haliamide	Haliangium ochraceum DSM 14365
BGC0001647.3	0.33	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001076.5	0.32	other (nucleoside)	liposidomycin B, liposidomycin A, liposidomycin C, liposidomycin Z, liposidomycin H, liposidomycin G, liposidomycin L, liposidomycin M, liposidomycin K, liposidomycin N	Streptomyces sp. SN-1061M
BGC0001881.4	0.31	NRPS, PKS	pyrichalasin H	Pyricularia grisea
BGC0001622.5	0.31	PKS	isatropolone A, isotropolone B, isotropolone C	Streptomyces sp.
BGC0000110.5	0.31	PKS	spectinabilin, orinocin, SNF4435C, SNF4435D	Streptomyces orinoci
BGC0001762.3	0.30	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033
BGC0001760.5	0.30	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000875.4	0.34	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0001367.5	0.34	NRPS, PKS	haliamide	Haliangium ochraceum DSM 14365
BGC0001647.3	0.33	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001076.5	0.32	other (nucleoside)	liposidomycin B, liposidomycin A, liposidomycin C, liposidomycin Z, liposidomycin H, liposidomycin G, liposidomycin L, liposidomycin M, liposidomycin K, liposidomycin N	Streptomyces sp. SN-1061M
BGC0001881.4	0.31	NRPS, PKS	pyrichalasin H	Pyricularia grisea
BGC0001622.5	0.31	PKS	isatropolone A, isotropolone B, isotropolone C	Streptomyces sp.
BGC0000110.5	0.31	PKS	spectinabilin, orinocin, SNF4435C, SNF4435D	Streptomyces orinoci
BGC0001762.3	0.30	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033
BGC0001760.5	0.30	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene	drimane-type		C15	C2-C7 + C6-C11	PP

Genes with terpene domains:

ctg6_572: T2TS

Domain 1 (301 - 795): Type 2 terpene synthase

Subtype: Sesquiterpene synthase, group b

Reactions:: FPP → sesquiterpene_C2-C7/C6-C11_PP

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.14 out of 23.43

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.13 out of 18.57

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.89 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.29 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.99 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.15 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.45 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.11 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.56 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.93 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.12 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.86 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
ToxT	Regulator of MSHA biosynthesis

JODQ01000006.1 - Region 6 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 844,423 - 894,841 nt. (total: 50,419 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg6_707: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg6_733: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg6_736: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

ctg6_710: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

ctg6_727: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002518.3	0.37	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0001844.4	0.33	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002171.2	0.33	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.33	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000528.5	0.32	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002496.3	0.30	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002518.3	0.50	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0001844.4	0.48	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (14):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.26 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.66 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.19 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.28 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.91 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.02 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.59 out of 30.22

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 844422 - 894841:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg6_727: fatty_acid - mal - X

CAL_domain (126..422): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 42.7
NH2: 28.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1082..1342): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.8
Methylmalonyl-CoA: 82.8
Methoxymalonyl-CoA: 81.3
Ethylmalonyl-CoA: 49.6
inactive: 47.4
Propionyl-CoA: 31.9
2-Methylbutyryl-CoA: 28.1
trans-1,2-CPDA: 25.0
fatty_acid: 24.4
CHC-CoA: 21.1
Isobutyryl-CoA: 16.2
Benzoyl-CoA: 11.8
Acetyl-CoA: 11.4
3-Methylbutyryl-CoA: 8.2

AMP-binding (2269..2625): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DARSHGLINK
Nearest Stachelhaus code(s):: Gln DACSTGVINK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000007.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 68,658 - 120,428 nt. (total: 51,771 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg7_63: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg7_78: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: sulfotransferase

ctg7_81: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Ligases: ligase

ctg7_70: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg7_75: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg7_76: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg7_77: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.12 out of 26.85

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.54 out of 30.22

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.82 out of 24.78

Confidence: medium

Additional weak hits (10):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.50 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.13 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.31 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.06 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 68657 - 120428:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg7_75: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (483..860): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DFTKVGHVGK
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (76% 8Å match); OH-Asp DLTKVGHVGK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg7_76: Gly - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (15..391): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1549..1962): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism

JODQ01000007.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 210,314 - 281,388 nt. (total: 71,075 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg7_192: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_199: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg7_201: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase acyltransferase

ctg7_191: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

ctg7_195: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg7_200: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase phosphatase

ctg7_180: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

ctg7_194: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase

ctg7_178: Diels-Alderase cyclase

extras: DA_cyclase: Diels-Alderase cyclase

Isomerases: racemase

ctg7_202: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

ctg7_179: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg7_197: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.09 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.94 out of 20.01

Confidence: medium

Additional weak hits (36):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.16 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.67 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.29 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.83 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.07 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.50 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.48 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.53 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.88 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.53 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.68 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.05 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.39 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.99 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.17 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.95 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.88 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.20 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 210313 - 281388:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - ccmal) + (Me-redmal) + (mal)
Non-colinear ordering:: ctg7_195 + ctg7_196 + ctg7_198 + ctg7_199 + ctg7_200

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg7_195: mal - mal - mal

PKS_AT (513..782): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 191.4
inactive: 105.7
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 49.2
Propionyl-CoA: 47.6
Isobutyryl-CoA: 32.0
fatty_acid: 17.4
Acetyl-CoA: 15.7
Ethylmalonyl-CoA: 15.3
2-Methylbutyryl-CoA: 10.6
Benzoyl-CoA: 9.1
trans-1,2-CPDA: 7.4
CHC-CoA: 5.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (1433..1659): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.5
inactive: 92.1
Methoxymalonyl-CoA: 63.6
Methylmalonyl-CoA: 59.9
Isobutyryl-CoA: 48.3
Propionyl-CoA: 39.4
Ethylmalonyl-CoA: 28.8
2-Methylbutyryl-CoA: 25.4
Acetyl-CoA: 22.3
Benzoyl-CoA: 17.6
CHC-CoA: 14.3
fatty_acid: 13.2
trans-1,2-CPDA: 12.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (3027..3299): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.0
inactive: 78.3
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 41.1
Isobutyryl-CoA: 25.4
Propionyl-CoA: 24.7
Acetyl-CoA: 13.7
fatty_acid: 10.5
Ethylmalonyl-CoA: 7.1
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg7_196: mal

PKS_AT (0..150): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 70.4
inactive: 33.9
Methoxymalonyl-CoA: 20.7
Propionyl-CoA: 17.0
Methylmalonyl-CoA: 15.1
Isobutyryl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg7_199: mmal

PKS_AT (0..158): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 86.3
Methoxymalonyl-CoA: 72.8
Ethylmalonyl-CoA: 67.7
trans-1,2-CPDA: 49.2
2-Methylbutyryl-CoA: 41.1
Isobutyryl-CoA: 40.6
Malonyl-CoA: 31.3
Propionyl-CoA: 30.9
3-Methylbutyryl-CoA: 24.3
CHC-CoA: 22.8
Benzoyl-CoA: 18.1
Acetyl-CoA: 15.0
fatty_acid: 9.6
inactive: 0.0

ctg7_200: mal

PKS_AT (584..877): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.2
inactive: 81.2
Methoxymalonyl-CoA: 55.9
Methylmalonyl-CoA: 49.0
Isobutyryl-CoA: 26.9
Propionyl-CoA: 23.8
Ethylmalonyl-CoA: 16.6
Acetyl-CoA: 12.6
fatty_acid: 9.3
CHC-CoA: 9.2
2-Methylbutyryl-CoA: 6.2
Benzoyl-CoA: 5.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000007.1 - Region 3 - 2dos

Download region GenBank file

Download region SVG

Location: 464,818 - 494,032 nt. (total: 29,215 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase transferase

ctg7_393: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg7_398: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: dehydratase hydratase

ctg7_395: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

ctg7_399: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthase

ctg7_385: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.46	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002439.3	0.41	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000719.5	0.40	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.38	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001206.5	0.37	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000897.5	0.34	other (other)	dehydrophos	Streptomyces luridus
BGC0000711.5	0.33	saccharide	neomycin	Streptomyces fradiae
BGC0000713.5	0.32	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000709.5	0.32	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001302.5	0.31	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.46	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002439.3	0.41	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000719.5	0.40	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.38	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001206.5	0.37	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000897.5	0.34	other (other)	dehydrophos	Streptomyces luridus
BGC0000711.5	0.33	saccharide	neomycin	Streptomyces fradiae
BGC0000713.5	0.32	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000709.5	0.32	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001302.5	0.31	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (12):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.26 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.38 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

JODQ01000007.1 - Region 4 - RRE-containing,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 580,280 - 610,574 nt. (total: 30,295 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg7_507: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Lyases: dehydratase

ctg7_510: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002337.2	0.46	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.45	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.44	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.38	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.37	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002317.2	0.35	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000553.3	0.35	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002337.2	0.56	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000518.3	0.54	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.50	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg7_497

ctg7_493

Leader:

MSYVLNLQATKVAAEAPGDGAD

Core:

SWLSFLSPVTCFSTTSLALC

Core with dehydrations:

DhaWLDhaFLDhaPVDhbCysFDhaDhbDhbDhaLALCys

antiSMASH-DB 4.0 matches for ctg7_493

100.0%

NZ_BBXF01000001.1:

Lanthipeptides: AW274_RS42545_lanthipeptide

1

SWLSFLSPVTCFSTTSLALC

20

SWLSFLSPVTCFSTTSLALC

1

SWLSFLSPVTCFSTTSLALC

20

50.0%

NZ_CP084585.1:

Lanthipeptides: allorf_0614669_0614794_lanthipeptide

3

LSFLSPVTCFSTTSLALC

20

LS S C+STTS LC

2

LSTTSNWLCYSTTSWFLC

19

45.0%

NZ_CP034539.1and 2 others:

NZ_FNHV01000016.1 Lanthipeptides: BLU79_RS34765_lanthipeptideNZ_JAIHON010000003.1 Lanthipeptides: K4B79_RS07725_lanthipeptide

Lanthipeptides: EJ357_RS03030_lanthipeptide

4

SFLSPVTCFSTTSLALC

20

S LS ++C S SL LC

1

STLSLLSCVSAASLTLC

17

with 12 more sequence matches

Only the first 10 are displayed here.

42.9%

NZ_CP021744.1and 3 others:

NZ_CP097123.1 Lanthipeptides: M1P56_RS05765_lanthipeptideNZ_JACHJF010000016.1 Lanthipeptides: FHS36_RS22695_lanthipeptideNZ_JAJQQQ010000006.1 Lanthipeptides: LUZ28_RS13020_lanthipeptide

Lanthipeptides: SMD11_RS23510_lanthipeptide

4

SFLSPVTCFSTTSLALC

20

S +S + C+ST S+ALC

4

SNVSLLLCWSTASVALC

20

40.0%

NZ_CP021080.1:

Lanthipeptides: LK06_RS01010_lanthipeptide

7

SPVTCFSTTSLALC

20

S ++C STTS+ LC

3

SLLSCVSTTSVLLC

16

40.0%

NZ_CP084585.1:

Lanthipeptides: allorf_0614982_0615095_lanthipeptide

2

WLSFLSPVTCFSTTSLALC

20

W+S S + C ST S+ C

1

WISSWSLIGCASTLSVGAC

19

40.0%

NZ_CP117866.1and 1 other:

NZ_RQJW01000015.1 Lanthipeptides: EHO50_RS37060_lanthipeptide

Lanthipeptides: PBV52_RS01370_lanthipeptide

6

LSPVTCFSTTSLALC

20

LS ++C S SL LC

2

LSLLSCVSAASLTLC

16

40.0%

NZ_MTBP01000002.1:

Lanthipeptides: BTM25_RS21150_lanthipeptide

3

LSFLSPVTCFSTTSLALC

20

+S++S + CFS S+ LC

1

VSYVSLLLCFSYASVLLC

18

40.0%

NZ_WUTW01000001.1:

Lanthipeptides: GQ466_RS00215_lanthipeptide

3

LSFLSPVTCFSTTSLALC

20

+S++S + CFS S+ LC

1

ISYISLLLCFSYASVFLC

18

38.1%

NZ_CP034587.1:

Lanthipeptides: EKH77_RS09240_lanthipeptide

4

SFLSPVTCFSTTSLALC

20

S +S ++C ST S+ LC

4

STVSLLSCISTASVLLC

20

35.0%

NZ_AUFR01000008.1:

Lanthipeptides: allorf_100347_100460_lanthipeptide

7

SPVTCFSTTSLALC

20

S TC+ST S+ C

2

SNWTCYSTHSIWFC

15

35.0%

NZ_BNBL01000010.1and 1 other:

NZ_CP071595.1 Lanthipeptides: J3S04_RS21315_lanthipeptide

Lanthipeptides: IE295_RS24405_lanthipeptide

11

CFSTTSLALC

20

C+ST S+ALC

10

CWSTASVALC

19

35.0%

NZ_CP033719.1:

Lanthipeptides: allorf_1492720_1492833_lanthipeptide

7

SPVTCFSTTSLALC

20

S TC+ST S+ C

2

SNWTCYSTRSIWFC

15

MIBiG 4.0 matches for ctg7_493

11.8%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

15

TSLALC

20

TS++LC

2

TSISLC

7

ctg7_496

Leader:

MAFVLDLQAREVSKEPAQ

Core:

LMGPSSVSPSFCISGLTLFLC

Core with dehydrations:

LMGPDhaDhaVDhaPDhaFCysIDhaGLDhbLFLCys

antiSMASH-DB 4.0 matches for ctg7_496

95.2%

NZ_BBXF01000001.1:

Lanthipeptides: allorf_1022647_1022766_lanthipeptide

1

LMGPSSVSPSFCISGLTLFLC

21

LMGPSS+SPSFCISGLTLFLC

1

LMGPSSLSPSFCISGLTLFLC

21

47.8%

NZ_CP007155.1:

Lanthipeptides: KALB_RS46315_lanthipeptide

3

GPSSVSPSFC--ISGLTLFLC

21

G S +S S C SGL+L LC

1

GGSHLSVSGCGGASGLSLLLC

21

42.9%

NZ_CP034587.1:

Lanthipeptides: EKH77_RS09240_lanthipeptide

3

GPSSVSPSFCISGLTLFLC

21

G S+VS CIS ++ LC

2

GQSTVSLLSCISTASVLLC

20

with 10 more sequence matches

38.1%

NZ_CP084585.1:

Lanthipeptides: allorf_0614669_0614794_lanthipeptide

3

GPSSVSPSFCISGLTLFLC

21

G S+ S C S + FLC

1

GLSTTSNWLCYSTTSWFLC

19

36.4%

NZ_CP031455.1:

Lanthipeptides: DXZ73_RS14610_lanthipeptide

3

GPSSVSPSFCISGLTLFLC

21

G S+VS C+S ++ LC

3

GASTVSLLSCVSTASILLC

21

33.3%

NZ_FNAD01000001.1:

Lanthipeptides: BLQ63_RS02575_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL++ LC

7

PSNLSAALCGGTSGLSILLC

26

33.3%

NZ_KV793075.1:

Lanthipeptides: allorf_038130_038252_lanthipeptide

9

PSFCISGLTLFLC

21

PS SGLTL C

9

PSLSASGLTLGSC

21

32.1%

NZ_RSEB01000004.1and 1 other:

NZ_WIAO01000001.1 Lanthipeptides: GFD30_RS00960_lanthipeptide

Lanthipeptides: EIW28_RS16895_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL++ LC

8

PSNLSATLCGGTSGLSVLLC

27

30.0%

NZ_FWXV01000003.1and 1 other:

NZ_SGWQ01000004.1 Lanthipeptides: EV193_RS13500_lanthipeptide

Lanthipeptides: B9C43_RS55710_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL+L +C

10

PSNLSVTLCGGTSGLSLLIC

29

30.0%

NZ_JAAATY010000001.1:

Lanthipeptides: GC106_RS02675_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL+L +C

10

PSNLSLTLCGGTSGLSLLIC

29

29.0%

NZ_FNGF01000002.1:

Lanthipeptides: BLS99_RS06065_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL++ LC

11

PSNLSATLCGGTSGLSILLC

30

25.8%

NC_013947.1:

Lanthipeptides: SNAS_RS34700_lanthipeptide

4

PSSVSPSFC--ISGLTLFLC

21

PS++S + C SGL++ +C

11

PSNLSATLCGGTSGLSVLIC

30

12.3%

NZ_CP020567.1:

Lanthipeptides: B6264_RS23085_lanthipeptide

4

PSSVSPSFCISG

15

PS V+PS C G

24

PSYVTPSQCTQG

35

MIBiG 4.0 matches for ctg7_496

18.2%

BGC0000563.4 (AEA03263.1):

Lanthipeptide: venezuelin

12

CISGLTLF

19

C+ LTL

5

CVGLLTLL

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.86 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (14):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.30 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.80 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.01 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.73 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.92 out of 30.11

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.12 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

ctg7_493 - Class III

Cleavage pHMM score: 6.80

RODEO score: 0

Monoisotopic mass: 2018.0 Da

Molecular weight: 2019.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2037.4 Da N = 1; 2055.4 Da N = 2; 2073.4 Da N = 3; 2091.4 Da N = 4; 2109.5 Da N = 5; 2127.5 Da N = 6

ctg7_496 - Class III

Cleavage pHMM score: 2.20

RODEO score: 0

Monoisotopic mass: 2050.1 Da

Molecular weight: 2051.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2069.5 Da N = 1; 2087.5 Da N = 2; 2105.5 Da N = 3; 2123.5 Da N = 4

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 92; Score: 59.1
: RRE type: Pantocin_Microcin_RRE; Location: 0 - 92; Score: 59.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor

JODQ01000007.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 700,244 - 721,347 nt. (total: 21,104 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg7_602: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

ctg7_597: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001387.5	0.38	other (other)	nucleocidin	Streptomyces calvus
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001687.3	0.31	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0001514.5	0.30	other (other)	aristeromycin	Streptomyces citricolor
BGC0000045.3	0.30	PKS	dehydrocurvularin	Aspergillus terreus
BGC0001366.5	0.30	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000821.5	0.29	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001513.3	0.29	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001387.5	0.38	other (other)	nucleocidin	Streptomyces calvus
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001687.3	0.31	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0001514.5	0.30	other (other)	aristeromycin	Streptomyces citricolor
BGC0000045.3	0.30	PKS	dehydrocurvularin	Aspergillus terreus
BGC0001366.5	0.30	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000821.5	0.29	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001513.3	0.29	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

ctg7_597: T1TS

Domain 1 (5 - 321): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.61 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (10):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.43 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.97 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.50 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.97 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.56 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000007.1 - Region 6 - NRPS,lassopeptide

Download region GenBank file

Download region SVG

Location: 721,979 - 772,769 nt. (total: 50,791 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg7_639: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg7_641: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: glycosyltransferase kinase

ctg7_623: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

ctg7_635: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

ctg7_612: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

ctg7_631: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: ligase

ctg7_621: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg7_624: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.39	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata
BGC0002053.3	0.37	ribosomal	ulleungdin	Streptomyces sp.
BGC0000342.4	0.36	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.36	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

Additional weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 8, location 721978 - 772769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 721978 - 771770:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg7_621: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (470..834): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DFTKIGHVGK
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg7_624: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (446..826): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 5 - 79; Score: 46.5

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

JODQ01000007.1 - Region 7 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,048,569 - 1,094,679 nt. (total: 46,111 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg7_914: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_933: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg7_934: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg7_935: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: methyltransferase

ctg7_905: methyltransferase

smcogs: SMCOG1248: methyltransferase

ctg7_932: methyltransferase

smcogs: SMCOG1248: methyltransferase

Ligases: synthase

ctg7_919: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg7_920: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg7_922: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (22):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.07 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.13 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.29 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.68 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.69 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.66 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.06 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.32 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.50 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.13 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.16 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 1048568 - 1094679:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 1048568 - 1092345:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 1052365 - 1094679:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg7_919: pk

PKS_AT (530..820): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 127.5
Ethylmalonyl-CoA: 114.3
Methoxymalonyl-CoA: 99.8
Malonyl-CoA: 94.4
Isobutyryl-CoA: 69.4
2-Methylbutyryl-CoA: 69.3
Propionyl-CoA: 68.8
trans-1,2-CPDA: 57.6
Benzoyl-CoA: 42.5
Acetyl-CoA: 35.1
3-Methylbutyryl-CoA: 33.7
CHC-CoA: 24.0
fatty_acid: 22.3
inactive: 19.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000008.1 - Region 1 - azole-containing-RiPP,thioamitides

Download region GenBank file

Download region SVG

Location: 108,931 - 137,179 nt. (total: 28,249 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg8_101: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

ctg8_98: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

ctg8_99: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: protease

ctg8_107: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

ctg8_91: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002099.3	0.47	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.47	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002391.2	0.39	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000575.5	0.32	ribosomal	lariatin	Rhodococcus jostii
BGC0002825.2	0.32	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001634.3	0.31	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001655.3	0.31	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001176.4	0.31	ribosomal	streptomonomicin	Streptomonospora alba

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000575.5	0.47	ribosomal	lariatin	Rhodococcus jostii
BGC0002825.2	0.46	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001634.3	0.46	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001655.3	0.46	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001176.4	0.46	ribosomal	streptomonomicin	Streptomonospora alba

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.12 out of 23.79

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.30 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.57 out of 26.06

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.03 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.33 out of 20.01

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.17 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.30 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.16 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 87; Score: 38.8
: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 87; Score: 38.8

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

Core peptide predictions

No core peptides found.

JODQ01000008.1 - Region 2 - azole-containing-RiPP,lanthipeptide-class-ii,terpene

Download region GenBank file

Download region SVG

Location: 170,314 - 211,376 nt. (total: 41,063 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

ctg8_144: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

ctg8_143: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

ctg8_158: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.44	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000565.5	0.41	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000496.5	0.39	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001579.4	0.38	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001555.4	0.38	ribosomal	colicin V	Escherichia coli chi7122
BGC0000554.4	0.37	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002005.2	0.37	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000528.5	0.37	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.67	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002699.2	0.57	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.57	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000565.5	0.55	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.54	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000496.5	0.54	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002485.2	0.53	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg8_158

allorf_186854_186937

Leader:

MSLFSHDSYHA

Core:

GLVLVVSGCQARIWRI

Core with dehydrations:

GLVLVVDhaGCysQARIWRI

antiSMASH-DB 4.0 matches for allorf_186854_186937

20.5%

NZ_LR134504.1:

Lanthipeptides: allorf_1621406_1621576_lanthipeptide

1

GLVLVVSGCQARIWR

15

GL L S C+A +WR

11

GLKLQFSTCEAWLWR

25

15.4%

NZ_JABBXA010000002.1:

Lanthipeptides: allorf_494858_495019_lanthipeptide

5

VVSGCQARIWR

15

V+ CQA WR

20

VLPACQASRWR

30

12.7%

NZ_EQ973330.1:

Lanthipeptides: allorf_437242_437442_lanthipeptide

2

LVLVVSGCQARIWR

15

L L +S C+A +WR

3

LKLQLSTCEAWLWR

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

ctg8_143: T1TS

Domain 1 (73 - 386): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.15 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.61 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.84 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.97 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.69 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

Terpene

TFBS Finder

Azole RiPPs

Core peptide predictions

allorf_186854_186937 - Class II: Cleavage pHMM score: -6.90; RODEO score: 0; Monoisotopic mass: 1751.0 Da; Molecular weight: 1752.1 Da; Number of bridges: 1

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 74.8; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 68.6; RRE type: Cyanobactin_D_RRE; Location: 5 - 79; Score: 62.4
: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 74.8; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 68.6; RRE type: Cyanobactin_D_RRE; Location: 5 - 79; Score: 62.4

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

Core peptide predictions

No core peptides found.

JODQ01000009.1 - Region 1 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 207,724 - 236,624 nt. (total: 28,901 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg9_240: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.42	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001146.5	0.39	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001640.3	0.38	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.37	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.33	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000613.5	0.33	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.33	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0000628.4	0.31	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001174.4	0.30	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001860.4	0.28	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.54	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001146.5	0.52	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001640.3	0.51	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.50	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.47	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000613.5	0.47	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.47	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0000628.4	0.46	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001174.4	0.45	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001860.4	0.43	ribosomal	thiomuracin	Thermobispora bispora DSM 43833

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.96 out of 30.22

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.85 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.89 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.36 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.61 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.50 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.14 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.01 out of 35.63

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 11 - 89; Score: 73.3
: RRE type: Thiopeptide_F_RRE; Location: 11 - 89; Score: 73.3

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
ClgR	Caseinolytic protease gene regulator
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

JODQ01000010.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 35,354 - 60,217 nt. (total: 24,864 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002115.3	0.56	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002560.3	0.55	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001638.4	0.50	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002699.2	0.48	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001802.5	0.47	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.47	ribosomal	neothioviridamide	Streptomyces sp.
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002115.3	0.56	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002560.3	0.55	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001638.4	0.50	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002699.2	0.48	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001802.5	0.47	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.47	ribosomal	neothioviridamide	Streptomyces sp.
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.96 out of 29.38

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.13 out of 28.19

Confidence: medium

Additional weak hits (24):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.07 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.46 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.84 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.96 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.73 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.78 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.24 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.92 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.06 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.84 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.54 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.59 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.19 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.80 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.75 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.14 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

JODQ01000010.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 146,560 - 222,040 nt. (total: 75,481 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg10_156: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: aminotransferase halogenase sulfotransferase

ctg10_150: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg10_154: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000028Halogenation (identity: 70.20%)
smcogs: SMCOG1119: halogenase

ctg10_164: Sulfotransferase domain

extras: Sulfotransfer_1: Sulfotransferase domain

Hydrolases: hydrolase

ctg10_159: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

ctg10_152: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg10_169: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.73	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.73	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (23):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.09 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.89 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.02 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.64 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.39 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.38 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.58 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.78 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.63 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.67 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.32 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.36 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 146559 - 222040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Asp - Asp) + (X - Asp - Ser - X - X - X) + (Val - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg10_152: Phe - Asp - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (447..835): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1484..1875): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2537..2933): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg10_167: X - Asp - Ser - X - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (465..855): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVEFQGTVTK
Nearest Stachelhaus code(s):: Arg DVEFIGAVTK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1523..1914): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2535..2917): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3572..3893): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGAVIK
Nearest Stachelhaus code(s):: Dhpg DALSVGTVIK (76% 8Å match); Hpg DALSIGAVIK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4546..4801): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DAL------K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMP-binding (5550..5919): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALSLGTVMK
Nearest Stachelhaus code(s):: Dhpg DALSVGTVMK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg10_168: Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (655..1042): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALWWGVVFK
Nearest Stachelhaus code(s):: Val or aIle DALWWGGVFK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1683..1939): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DAL------K
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg10_169: X

AMP-binding (743..995): X

nrpys: Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLAQCAAVCK
Nearest Stachelhaus code(s):: Tyr DAATVAAVCK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000013.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 84,184 - 94,984 nt. (total: 10,801 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4
BGC0001882.3	0.27	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0002477.3	0.26	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001596.3	0.25	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001904.2	0.24	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4
BGC0001882.3	0.27	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0002477.3	0.26	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001596.3	0.25	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001904.2	0.24	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.98 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

JODQ01000013.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 107,662 - 162,853 nt. (total: 55,192 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg13_116: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

ctg13_129: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: glucosidase hydrolase

ctg13_122: isochorismatase

smcogs: SMCOG1027: isochorismatase

ctg13_141: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase

ctg13_147: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

ctg13_131: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg13_134: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg13_135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg13_136: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

ctg13_144: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.28 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

Additional weak hits (18):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.92 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.84 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.16 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.92 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.63 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.50 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.64 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.73 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.21 out of 25.88

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.32 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.85 out of 27.18

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.74 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.78 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.70 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 107661 - 162853:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg13_131: X

AMP-binding (442..810): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAGDMGHVCK
Nearest Stachelhaus code(s):: CysA DATKMGHVGK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

ctg13_134: X

AMP-binding (425..799): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAEDIGTVIK
Nearest Stachelhaus code(s):: Lys DAESIGTVIK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg13_135: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (432..811): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg13_136: X

AMP-binding (10..378): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAMFSSYPAK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

JODQ01000014.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 177,640 - 198,560 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg14_185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfhydrylase

ctg14_182: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase

ctg14_188: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthetase

ctg14_184: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000815.4	0.43	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000783.3	0.40	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001197.5	0.39	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000252.5	0.39	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000815.4	0.43	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000783.3	0.40	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001197.5	0.39	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000252.5	0.39	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg14_184: PT_FPPS_like

Domain 1 (51 - 280): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.83 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 32.93

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.80 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.28 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
VqsM	Regulator of quorum-sensing signalling systems

JODQ01000015.1 - Region 1 - NRPS-like,azole-containing-RiPP,benzoxazole

Download region GenBank file

Download region SVG

Location: 248,257 - 313,161 nt. (total: 64,905 nt) Show pHMM detection rules used

benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

ctg15_246: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg15_258: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg15_262: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

ctg15_267: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg15_271: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase sulfotransferase transketolase

ctg15_261: transketolase

smcogs: SMCOG1204: transketolase

ctg15_266: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

ctg15_268: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: back translocase hydrolase

ctg15_243: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

ctg15_245: isochorismatase

smcogs: SMCOG1027: isochorismatase

ctg15_270: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Isomerases: isomerase

ctg15_244: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

ctg15_251: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

ctg15_249: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg15_250: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg15_252: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg15_254: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg15_259: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg15_260: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.80	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.77	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.57	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.72	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.43 out of 26.85

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

Additional weak hits (27):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.83 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.95 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.10 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.72 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.71 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.72 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.02 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.03 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.78 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.05 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.50 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.71 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.23 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.66 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.18 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.16 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 1, location 248256 - 313161:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 248256 - 293749:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg15_249: X

AMP-binding (32..407): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWPSQGVLSK
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg15_252: X

AMP-binding (138..527): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GMVLRCLVVK
Nearest Stachelhaus code(s):: Boz GMVLRAVVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg15_259: X

AMP-binding (9..392): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AGWMAGLCVK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 2 - 96; Score: 66.9; RRE type: NHLP_CD_RRE; Location: 2 - 92; Score: 44.1; RRE type: Cyanobactin_D_RRE; Location: 2 - 56; Score: 31.7

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
ColR	Phenol-responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism

Core peptide predictions

No core peptides found.

JODQ01000017.1 - Region 1 - NRPS,T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 32,396 nt. (total: 32,396 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg17_11: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Lyases: hydratase

ctg17_3: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg17_4: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

ctg17_5: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

ctg17_2: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg17_6: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.85	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.56 out of 20.97

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.08 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.10 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.31 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.45 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.73 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 32396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 28666:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg17_2: X - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (782..1178): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGAVIK
Nearest Stachelhaus code(s):: Dhpg DALSVGTVIK (76% 8Å match); Hpg DALSIGAVIK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1820..2215): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

JODQ01000018.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 4,205 - 26,715 nt. (total: 22,511 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

ctg18_23: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Translocases: transporter

ctg18_20: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg18_13

ctg18_12

Leader:

MVLLDLQAMELPGGGY

Core:

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

Core with dehydrations:

PGGGGHGGGGDhaDhbLDhbLLGCysADhaQDhbPDhaNLDhaLLLCysH

antiSMASH-DB 4.0 matches for ctg18_12

100.0%

NZ_BBXE01000034.1and 2 others:

NZ_BBXG01000007.1 Lanthipeptides: AW270_RS38750_lanthipeptideNZ_WXEW01000008.1 Lanthipeptides: GT755_RS26540_lanthipeptide

Lanthipeptides: AW273_RS37520_lanthipeptide

1

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

1

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

93.9%

NZ_BBXC01000011.1and 1 other:

NZ_BBXF01000002.1 Lanthipeptides: AW274_RS40200_lanthipeptide

Lanthipeptides: AW271_RS39780_lanthipeptide

2

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

3

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

33

93.8%

NZ_BBXD01000008.1:

Lanthipeptides: AW272_RS41775_lanthipeptide

2

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGG GGGGSTLTLLGCASQTPSNLSLLLCH

1

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

31

with 85 more sequence matches

Only the first 10 are displayed here.

75.0%

NZ_SLWR01000003.1:

Lanthipeptides: EV646_RS09945_lanthipeptide

6

HGGGGSTLTLLGCASQTPSNLSLLLCH

32

H GGSTLT+LGCASQTPSNLSLLLCH

1

HHPGGSTLTVLGCASQTPSNLSLLLCH

27

75.0%

NZ_SOCE01000001.1:

Lanthipeptides: EV138_RS20105_lanthipeptide

6

HGGGGSTLTLLGCASQTPSNLSLLLCH

32

H GGGSTLT+LGCAS TPSNLSLLLCH

1

HHGGGSTLTVLGCASHTPSNLSLLLCH

27

71.9%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGCAS TPSNLSL+LCH

1

GGGGSTLTVLGCASVTPSNLSLILCH

26

71.9%

NZ_CP043661.1:

Lanthipeptides: F1D05_RS17325_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS TPSNLSLLLCH

2

GGGSTLTVLGCASHTPSNLSLLLCH

26

71.9%

NZ_SHKR01000011.1and 6 others:

NZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

9

GGSTLTLLGCASQTPSNLSLLLCH

32

GGSTLT+LGCASQTPSNLSLLLCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

68.8%

NC_013595.1:

Lanthipeptides: SROS_RS48825_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCESYKPSNLSLLLCH

26

68.8%

NC_013729.1:

Lanthipeptides: KFLA_RS37060_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCGSAKPSNLSLLLCH

26

68.8%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS TPSNLSL+LCH

1

GGGSTLTVLGCASVTPSNLSLVLCH

25

68.8%

NZ_JACDUR010000003.1and 1 other:

NZ_JACDUR010000003.1 Lanthipeptides: HNR30_RS17930_lanthipeptide

Lanthipeptides: HNR30_RS17930_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGC S TPSNLSLLLCH

3

GGGSTLTVLGCNSYTPSNLSLLLCH

27

68.8%

NZ_JACHWA010000004.1and 1 other:

NZ_PVZV01000008.1 Lanthipeptides: C2865_RS30430_lanthipeptide

Lanthipeptides: FHS43_RS13815_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS PSNLSLLLCH

3

GGGSTLTVLGCASAKPSNLSLLLCH

27

MIBiG 4.0 matches for ctg18_12

18.8%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

5

GHGGGGSTLT

14

G+ GG TLT

13

GNNGGWCTLT

22

12.5%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

2

GGGGH

6

GG GH

1

GGAGH

5

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.74 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.35 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

ctg18_12 - Class III

Cleavage pHMM score: 4.70

RODEO score: 0

Monoisotopic mass: 2835.4 Da

Molecular weight: 2837.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2855.2 Da N = 1; 2873.2 Da N = 2; 2891.2 Da N = 3; 2909.2 Da N = 4; 2927.3 Da N = 5

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

JODQ01000021.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 15,778 nt. (total: 15,778 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg21_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg21_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg21_3: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 15778:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Asn) + (X - Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

ctg21_1: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (205..585): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code(s):: Asp DLTKVGHIGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg21_2: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (466..844): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg21_3: X - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (729..1071): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGAVIK
Nearest Stachelhaus code(s):: Dhpg DALSVGTVIK (76% 8Å match); Hpg DALSIGAVIK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1690..2064): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

JODQ01000024.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,840 nt. (total: 1,840 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg24_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains