Kribbella_albertanoniae_JCM_30547_WDCM2025 - 27 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

BAAHCN010000024.1 (Kribbella albertanoniae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	lassopeptide	67,031	89,551	Low	anantin C	ribosomal:RiPP
Region 24.2	lanthipeptide-class-iv	490,475	512,661
Region 24.3	redox-cofactor	1,056,099	1,078,118	Low	lankacidin C	NRPS:Type I+PKS
Region 24.4	NI-siderophore	1,507,300	1,536,904
Region 24.5	terpene-precursor	1,905,365	1,926,423
Region 24.6	NI-siderophore	2,052,552	2,080,869
Region 24.7	NRPS,T1PKS	2,233,531	2,284,138
Region 24.8	T3PKS	2,322,048	2,363,097	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 24.9	lanthipeptide-class-ii	2,528,343	2,551,426
Region 24.10	terpene	2,590,235	2,610,585
Region 24.11	hglE-KS,T1PKS	3,040,112	3,089,875
Region 24.12	NI-siderophore,terpene	3,193,750	3,241,759	Low	peucechelin	NRPS:Type I
Region 24.13	ectoine	3,372,243	3,382,617	Medium	showdomycin	other:other
Region 24.14	RRE-containing	3,407,355	3,428,446	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I
Region 24.15	lanthipeptide-class-i	3,440,580	3,464,724
Region 24.16	lanthipeptide-class-iv	4,023,522	4,046,185
Region 24.17	betalactone,butyrolactone	4,681,079	4,710,424
Region 24.18	NAPAA	4,798,246	4,832,178	High	ε-Poly-L-lysine	NRPS:Type I
Region 24.19	T1PKS,NRPS-like	5,358,694	5,403,546
Region 24.20	NRPS-like	5,993,646	6,037,896
Region 24.21	lanthipeptide-class-i	6,544,112	6,569,439
Region 24.22	lanthipeptide-class-ii	6,766,352	6,789,045
Region 24.23	lanthipeptide-class-iii	6,791,999	6,814,590	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 24.24	arylpolyene	7,246,246	7,287,247	Low	arylomycin	NRPS:Type I
Region 24.25	NRPS,T1PKS	7,434,930	7,485,123
Region 24.26	HR-T2PKS,NRPS	8,172,758	8,248,815	Low	metatricycloene	PKS
Region 24.27	aminopolycarboxylic-acid	9,477,357	9,490,741	Low	Ethylenediaminesuccinic acid hydroxyarginine	other:other

No secondary metabolite regions were found in these records:: BAAHCN010000001.1 (Kribbella albertanoniae); BAAHCN010000002.1 (Kribbella albertanoniae); BAAHCN010000003.1 (Kribbella albertanoniae); BAAHCN010000004.1 (Kribbella albertanoniae); BAAHCN010000005.1 (Kribbella albertanoniae); BAAHCN010000006.1 (Kribbella albertanoniae); BAAHCN010000007.1 (Kribbella albertanoniae); BAAHCN010000008.1 (Kribbella albertanoniae); BAAHCN010000009.1 (Kribbella albertanoniae); BAAHCN010000010.1 (Kribbella albertanoniae); BAAHCN010000011.1 (Kribbella albertanoniae); BAAHCN010000012.1 (Kribbella albertanoniae); BAAHCN010000013.1 (Kribbella albertanoniae); BAAHCN010000014.1 (Kribbella albertanoniae); BAAHCN010000015.1 (Kribbella albertanoniae); BAAHCN010000016.1 (Kribbella albertanoniae); BAAHCN010000017.1 (Kribbella albertanoniae); BAAHCN010000018.1 (Kribbella albertanoniae); BAAHCN010000019.1 (Kribbella albertanoniae); BAAHCN010000020.1 (Kribbella albertanoniae); BAAHCN010000021.1 (Kribbella albertanoniae); BAAHCN010000022.1 (Kribbella albertanoniae); BAAHCN010000023.1 (Kribbella albertanoniae); BAAHCN010000025.1 (Kribbella albertanoniae); BAAHCN010000026.1 (Kribbella albertanoniae); BAAHCN010000027.1 (Kribbella albertanoniae); BAAHCN010000028.1 (Kribbella albertanoniae); BAAHCN010000029.1 (Kribbella albertanoniae)

Compact view

BAAHCN010000024.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 67,031 - 89,551 nt. (total: 22,521 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GCM10029976_005730: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Hydrolases: hydrolase

GCM10029976_005690: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

GCM10029976_005770: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: hydratase

GCM10029976_005860: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

GCM10029976_005870: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Translocases: transport

GCM10029976_005850: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.71	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002053.3	0.71	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.66	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002064.2	0.62	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001548.4	0.59	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.58	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.71	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002053.3	0.71	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001539.4	0.66	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.64	ribosomal	sphaericin	Planomonospora sphaerica
BGC0002064.2	0.62	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001548.4	0.59	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.58	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

Additional weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.52 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 32.93

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 83; Score: 74.3

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 2 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 490,475 - 512,661 nt. (total: 22,187 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10029976_009560: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: cyclase

GCM10029976_009570: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Translocases: transport

GCM10029976_009500: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.59	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.59	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.58	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0001364.3	0.48	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.59	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.59	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.58	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0001364.3	0.48	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.67 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.98 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

BAAHCN010000024.1 - Region 3 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 1,056,099 - 1,078,118 nt. (total: 22,020 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: phosphatase

GCM10029976_014760: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: decarboxylase

GCM10029976_014770: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.46	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001478.5	0.41	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001486.4	0.40	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0002692.2	0.39	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000339.5	0.35	NRPS	echinomycin	Streptomyces lasaliensis
BGC0000415.5	0.35	NRPS	quinomycin	Streptomyces griseovariabilis subsp. bandungensis
BGC0001228.5	0.35	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.46	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001478.5	0.41	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001486.4	0.40	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0002692.2	0.39	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000339.5	0.35	NRPS	echinomycin	Streptomyces lasaliensis
BGC0000415.5	0.35	NRPS	quinomycin	Streptomyces griseovariabilis subsp. bandungensis
BGC0001228.5	0.35	NRPS	retimycin A	Salinispora arenicola CNT005
BGC0002012.4	0.34	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (3):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.41 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 81; Score: 67.2

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

BAAHCN010000024.1 - Region 4 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,507,300 - 1,536,904 nt. (total: 29,605 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

GCM10029976_018990: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

GCM10029976_019010: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000548.4	0.45	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000521.3	0.44	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000546.3	0.43	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.47	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000548.4	0.45	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000521.3	0.44	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002682.2	0.44	other (other)	aerobactin	Vibrio mimicus
BGC0000939.5	0.43	other (other)	aerobactin	Grimontia hollisae
BGC0001498.5	0.43	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000546.3	0.43	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.20 out of 36.53

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 24.53 out of 25.31

Confidence: strong

Additional weak hits (2):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.56 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor

BAAHCN010000024.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,905,365 - 1,926,423 nt. (total: 21,059 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10029976_022660: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

GCM10029976_022750: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

GCM10029976_022740: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Hydrolases: dehalogenase

GCM10029976_022710: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthetase

GCM10029976_022700: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.52	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002402.2	0.44	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000664.5	0.43	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.42	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000843.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.52	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002402.2	0.44	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000664.5	0.43	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.43	terpene	isorenieratene	Streptomyces argillaceus
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000633.3	0.42	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.42	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.42	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000843.5	0.40	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

GCM10029976_022700: PT_FPPS_like

Domain 1 (40 - 343): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.27 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.07 out of 24.78

Confidence: medium

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.11 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 6 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 2,052,552 - 2,080,869 nt. (total: 28,318 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase transferase

GCM10029976_023990: sugar transferase

smcogs: SMCOG1146: sugar transferase

GCM10029976_024010: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

GCM10029976_024070: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GCM10029976_024110: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

GCM10029976_023970: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

GCM10029976_023980: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

GCM10029976_024130: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000769.3	0.54	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000787.3	0.53	saccharide	O-antigen	Escherichia coli
BGC0000733.3	0.52	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000732.3	0.52	saccharide	capsular polysaccharide	Raoultella planticola
BGC0000742.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000788.3	0.48	saccharide	O-antigen	Salmonella enterica subsp. salamae serovar Greenside
BGC0000741.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000769.3	0.54	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000787.3	0.53	saccharide	O-antigen	Escherichia coli
BGC0000733.3	0.52	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000732.3	0.52	saccharide	capsular polysaccharide	Raoultella planticola
BGC0000742.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.49	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000788.3	0.48	saccharide	O-antigen	Salmonella enterica subsp. salamae serovar Greenside
BGC0000741.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.20 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.15 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.57 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

BAAHCN010000024.1 - Region 7 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 2,233,531 - 2,284,138 nt. (total: 50,608 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

GCM10029976_025600: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

GCM10029976_025790: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

GCM10029976_025820: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10029976_025830: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: transketolase

GCM10029976_025810: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: deaminase esterase glucosidase

GCM10029976_025700: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

GCM10029976_025730: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

GCM10029976_025900: putative esterase

smcogs: SMCOG1104: putative esterase

Isomerases: mutase

GCM10029976_025670: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

GCM10029976_025770: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000393.5	0.27	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0000896.5	0.24	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000171.5	0.23	PKS	9-methylstreptimidone	Streptomyces himastatinicus ATCC 53653
BGC0000877.5	0.23	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001510.5	0.22	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000190.5	0.22	PKS	A-74528	Streptomyces sp. SANK 61196
BGC0000872.5	0.22	other (other)	A-90289 A, A-90289 B	Streptomyces sp. SANK 60405
BGC0002042.3	0.22	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0000224.4	0.21	PKS	fredericamycin A	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000393.5	0.42	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0000896.5	0.39	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000171.5	0.39	PKS	9-methylstreptimidone	Streptomyces himastatinicus ATCC 53653
BGC0000877.5	0.38	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001510.5	0.38	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0000190.5	0.38	PKS	A-74528	Streptomyces sp. SANK 61196
BGC0000872.5	0.37	other (other)	A-90289 A, A-90289 B	Streptomyces sp. SANK 60405
BGC0002042.3	0.37	NRPS	anthelvencin A, anthelvencin B, anthelvencin C	Streptomyces venezuelae
BGC0000224.4	0.37	PKS	fredericamycin A	Streptomyces griseus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.19 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (13):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.58 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.36 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.39 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.00 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.14 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.52 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.17 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 2233530 - 2284138:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_025770: X - mal - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (49..483): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -ALWVGATGK
Nearest Stachelhaus code(s):: Ppa VALFVGAAGK (50% 8Å match); 3clLeu GILWVGAGGK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

PKS_AT (2083..2366): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.0
inactive: 59.0
Methylmalonyl-CoA: 57.8
Methoxymalonyl-CoA: 46.5
Ethylmalonyl-CoA: 29.9
CHC-CoA: 29.7
Propionyl-CoA: 26.9
Benzoyl-CoA: 26.4
fatty_acid: 22.9
Isobutyryl-CoA: 22.8
2-Methylbutyryl-CoA: 22.3
Acetyl-CoA: 21.1
trans-1,2-CPDA: 17.8
3-Methylbutyryl-CoA: 16.5

AMP-binding (3046..3438): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFVGEIVK
Nearest Stachelhaus code(s):: Trp or Pro DVYFVGGICK (53% 8Å match); Trp DVAVVGEVVK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
DmdR1	Iron(II)-dependent repressor

BAAHCN010000024.1 - Region 8 - T3PKS

Download region GenBank file

Download region SVG

Location: 2,322,048 - 2,363,097 nt. (total: 41,050 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10029976_026360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

GCM10029976_026380: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

GCM10029976_026420: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

GCM10029976_026510: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

GCM10029976_026430: Methylation

MITE: MITE0000155Methylation (identity: 66.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: synthase

GCM10029976_026440: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001905.4	0.49	PKS	violapyrone B	Streptomyces somaliensis
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001647.3	0.41	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.41	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000252.5	0.38	PKS	nonactin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001905.4	0.49	PKS	violapyrone B	Streptomyces somaliensis
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001647.3	0.41	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.41	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000252.5	0.38	PKS	nonactin	Streptomyces griseus subsp. griseus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.63 out of 24.78

Confidence: medium

Additional weak hits (11):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.63 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.20 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.06 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.75 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.15 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.36 out of 23.43

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response

BAAHCN010000024.1 - Region 9 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 2,528,343 - 2,551,426 nt. (total: 23,084 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

GCM10029976_028250: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Hydrolases: hydrolase protease

GCM10029976_028200: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10029976_028210: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10029976_028360: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

GCM10029976_028230: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.51	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.50	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.50	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.49	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000504.5	0.49	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001407.5	0.49	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000554.4	0.49	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.5	0.48	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001210.5	0.51	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.50	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.50	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.49	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000504.5	0.49	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001407.5	0.49	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000554.4	0.49	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.5	0.48	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GCM10029976_028230

allorf_2551038_2551259

Leader:

MPWCQPDPWWQPVPCRGASPIRGGSPCRAVVPARAVVAARAEPWCQPDPWWQPVPSRGASPIRGA

Core:

SPCRPVVI

Core with dehydrations:

DhaPCysRPVVI

antiSMASH-DB 4.0 matches for allorf_2551038_2551259

75.0%

NZ_LT630004.1:

Lanthipeptides: allorf_2780927_2781046_lanthipeptide

1

SPCRPVV

7

SPC PVV

1

SPCHPVV

7

17.2%

NZ_LMHM01000017.1:

Lanthipeptides: allorf_240600_240725_lanthipeptide

2

PCRPVV

7

PCRP+V

6

PCRPLV

11

allorf_2551290_2551421

Leader:

MTCALPSVGMTVPSTLDPVASA

Core:

PVRMSFRGACSRRLACSSSAC

Core with dehydrations:

PVRMDhaFRGACysDhaRRLACysDhaDhaDhaACys

antiSMASH-DB 4.0 matches for allorf_2551290_2551421

20.0%

NZ_VFNO01000010.1:

Lanthipeptides: allorf_179113_179274_lanthipeptide

10

CSRRLACSSSAC

21

C+ R+ACS+ C

6

CTSRIACSTGDC

17

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.94 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.82 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.69 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_2551038_2551259 - Class II

Cleavage pHMM score: -5.30

RODEO score: 0

Monoisotopic mass: 851.5 Da

Molecular weight: 852.1 Da

Number of bridges: 1

allorf_2551290_2551421 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 2154.0 Da

Molecular weight: 2155.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2173.6 Da N = 1; 2191.6 Da N = 2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor

BAAHCN010000024.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 2,590,235 - 2,610,585 nt. (total: 20,351 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

GCM10029976_028770: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Ligases: synthase

GCM10029976_028760: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0000798.3	0.42	saccharide	dhurrin	Sorghum bicolor
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001528.4	0.40	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000636.3	0.36	terpene	carotenoid	Brevibacterium linens
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001969.3	0.46	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0000798.3	0.42	saccharide	dhurrin	Sorghum bicolor
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001528.4	0.40	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000636.3	0.36	terpene	carotenoid	Brevibacterium linens
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

GCM10029976_028790: Lycopene_cycl

Domain 1 (6 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (1):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

BAAHCN010000024.1 - Region 11 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 3,040,112 - 3,089,875 nt. (total: 49,764 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

GCM10029976_033260: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

GCM10029976_033350: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_033500: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10029976_033530: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_033550: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: glycosyltransferase

GCM10029976_033460: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase

GCM10029976_033290: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

GCM10029976_033450: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

GCM10029976_033420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10029976_033430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.58	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.51	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.49	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.44	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.44	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0000861.5	0.55	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0002648.2	0.55	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.71 out of 25.88

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.97 out of 26.85

Confidence: medium

Additional weak hits (4):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.10 out of 20.01

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.36 out of 29.51

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.55 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.18 out of 32.93

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 3040111 - 3089875:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)
Non-colinear ordering:: GCM10029976_033420 + GCM10029976_033430 + GCM10029976_033440

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_033420: mal

PKS_AT (748..1043): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 66.4
Methylmalonyl-CoA: 34.2
Methoxymalonyl-CoA: 32.2
inactive: 25.7
Propionyl-CoA: 19.1
2-Methylbutyryl-CoA: 14.8
CHC-CoA: 14.2
fatty_acid: 11.7
Isobutyryl-CoA: 8.3
trans-1,2-CPDA: 7.1
Ethylmalonyl-CoA: 6.3
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Benzoyl-CoA: -0.8

GCM10029976_033430: mal

PKS_AT (618..829): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 4.8
Methylmalonyl-CoA: 4.6
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 12 - NI-siderophore,terpene

Download region GenBank file

Download region SVG

Location: 3,193,750 - 3,241,759 nt. (total: 48,010 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10029976_034600: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_034720: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: kinase

GCM10029976_034910: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase hydrolase

GCM10029976_034710: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

GCM10029976_034780: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: cyclase decarboxylase lyase

GCM10029976_034640: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

GCM10029976_034670: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

GCM10029976_034800: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

GCM10029976_034820: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.55	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000946.5	0.33	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.29	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.26	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002397.2	0.25	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.24	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001364.3	0.23	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002400.2	0.22	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001735.5	0.22	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000947.5	0.21	other (other)	vibrioferrin	Vibrio alginolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000947.5	0.57	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.51	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

GCM10029976_034800: T1TS + T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

GCM10029976_034820: PT_FPPS_like

Domain 1 (62 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.18 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (4):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.60 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

BAAHCN010000024.1 - Region 13 - ectoine

Download region GenBank file

Download region SVG

Location: 3,372,243 - 3,382,617 nt. (total: 10,375 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10029976_036240: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase

GCM10029976_036270: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.64	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.64	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.59	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (5):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.18 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.28 out of 26.85

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 14 - RRE-containing

Download region GenBank file

Download region SVG

Location: 3,407,355 - 3,428,446 nt. (total: 21,092 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

GCM10029976_036660: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002064.2	0.30	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001596.3	0.29	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000204.5	0.27	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000821.5	0.27	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001387.5	0.27	other (other)	nucleocidin	Streptomyces calvus
BGC0001029.5	0.27	NRPS, PKS	nostophycin	Nostoc sp. 152
BGC0000632.5	0.26	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000877.5	0.26	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002064.2	0.30	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0001596.3	0.29	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000204.5	0.27	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000821.5	0.27	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001387.5	0.27	other (other)	nucleocidin	Streptomyces calvus
BGC0001029.5	0.27	NRPS, PKS	nostophycin	Nostoc sp. 152
BGC0000632.5	0.26	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000877.5	0.26	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 93; Score: 53.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 15 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,440,580 - 3,464,724 nt. (total: 24,145 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase esterase

GCM10029976_036990: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

GCM10029976_037000: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase dehydratase

GCM10029976_037050: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

GCM10029976_037060: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000542.3	0.49	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0002635.2	0.45	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000515.4	0.44	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000559.4	0.43	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000542.3	0.49	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0002635.2	0.45	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000515.4	0.44	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000559.4	0.43	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (5):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.03 out of 25.88

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.70 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.73 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.06 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 143 - 233; Score: 49.8

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 16 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 4,023,522 - 4,046,185 nt. (total: 22,664 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

GCM10029976_042630: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.47	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0000874.5	0.41	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001544.3	0.34	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002482.2	0.33	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001124.4	0.32	PKS	pyranonigrin E	Aspergillus niger ATCC 1015
BGC0000275.4	0.31	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001582.4	0.31	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001295.5	0.31	other (other)	cremeomycin	Streptomyces cremeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.47	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0000874.5	0.41	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001544.3	0.34	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001221.5	0.34	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002482.2	0.33	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001124.4	0.32	PKS	pyranonigrin E	Aspergillus niger ATCC 1015
BGC0000275.4	0.31	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001582.4	0.31	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001295.5	0.31	other (other)	cremeomycin	Streptomyces cremeus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (2):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.50 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

BAAHCN010000024.1 - Region 17 - betalactone,butyrolactone

Download region GenBank file

Download region SVG

Location: 4,681,079 - 4,710,424 nt. (total: 29,346 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

GCM10029976_048610: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10029976_048620: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

GCM10029976_048660: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

GCM10029976_048760: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase carboxylase kinase

GCM10029976_048670: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

GCM10029976_048710: aminotransferase

smcogs: SMCOG1019: aminotransferase

GCM10029976_048820: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: amidase

GCM10029976_048810: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase synthase

GCM10029976_048630: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

GCM10029976_048700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.93	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.48	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002276.2	0.48	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000850.5	0.42	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001928.2	0.35	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.32	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002496.3	0.26	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000188.5	0.25	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000507.5	0.24	ribosomal	epicidin	Staphylococcus epidermidis
BGC0000509.4	0.24	ribosomal	epilancin 15x	Staphylococcus epidermidis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000849.4	0.58	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002277.2	0.56	NRPS	atromentin	Suillus grevillei
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002578.2	0.50	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000895.5	0.44	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002369.2	0.44	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.95 out of 36.54

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.82 out of 25.88

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

BAAHCN010000024.1 - Region 18 - NAPAA

Download region GenBank file

Download region SVG

Location: 4,798,246 - 4,832,178 nt. (total: 33,933 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: hydratase

GCM10029976_049820: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase

GCM10029976_049790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.19 out of 36.53

Confidence: medium

Additional weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.93 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.79 out of 30.22

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 22, location 4798245 - 4832178:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_049790: X

AMP-binding (20..421): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAESIGTVVK
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor

BAAHCN010000024.1 - Region 19 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 5,358,694 - 5,403,546 nt. (total: 44,853 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10029976_055090: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

GCM10029976_055100: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase transferase

GCM10029976_054940: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

GCM10029976_054980: methyltransferase

smcogs: SMCOG1089: methyltransferase

GCM10029976_055060: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

GCM10029976_055120: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase phosphatase

GCM10029976_055040: thioesterase

smcogs: SMCOG1004: thioesterase

GCM10029976_055110: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: dehydratase lyase

GCM10029976_054930: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

GCM10029976_055000: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

GCM10029976_055050: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

GCM10029976_054870: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

GCM10029976_055020: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10029976_055030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10029976_055140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (2):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.66 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.29 out of 21.55

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 23, location 5358693 - 5403546:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_055020: mal

PKS_AT (526..812): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.2
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 52.4
inactive: 49.4
Propionyl-CoA: 39.1
Isobutyryl-CoA: 34.7
2-Methylbutyryl-CoA: 26.1
CHC-CoA: 19.7
Benzoyl-CoA: 16.1
3-Methylbutyryl-CoA: 12.9
Acetyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0

GCM10029976_055030: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (29..424): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DALWVGGTFK
Nearest Stachelhaus code(s):: Val DALWLGGTFK (85% 8Å match); bOH-Val DALWLGGTFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 20 - NRPS-like

Download region GenBank file

Download region SVG

Location: 5,993,646 - 6,037,896 nt. (total: 44,251 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

GCM10029976_061300: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase formyltransferase

GCM10029976_061190: aminotransferase

smcogs: SMCOG1019: aminotransferase

GCM10029976_061270: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.20 out of 20.97

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.68 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.46 out of 23.43

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.94 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.75 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.20 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.30 out of 23.43

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 5993645 - 6037896:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_061270: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (479..862): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

BAAHCN010000024.1 - Region 21 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 6,544,112 - 6,569,439 nt. (total: 25,328 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

GCM10029976_066470: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

GCM10029976_066480: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

GCM10029976_066490: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.48	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.43	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.48	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.43	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.86 out of 23.79

Confidence: medium

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.06 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.45 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 157 - 250; Score: 65.7

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

BAAHCN010000024.1 - Region 22 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 6,766,352 - 6,789,045 nt. (total: 22,694 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

GCM10029976_068570: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

GCM10029976_068580: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

GCM10029976_068610: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

GCM10029976_068550: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001579.4	0.43	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.48	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001579.4	0.43	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GCM10029976_068550

GCM10029976_068560

Leader:

MKAQAVQELLGQYAGVSGGGQVVAG

Core:

DSEQGLQAVHERLLPFFAGCHRGCARVGGGAALDVLGPGWHAAGPLN

Core with dehydrations:

DDhaEQGLQAVHERLLPFFAGCysHRGCysARVGGGAALDVLGPGWHAAGPLN

antiSMASH-DB 4.0 matches for GCM10029976_068560

19.1%

NZ_CP043661.1and 1 other:

NZ_SOCE01000001.1 Lanthipeptides: EV138_RS20105_lanthipeptide

Lanthipeptides: F1D05_RS17325_lanthipeptide

28

GGGAALDVLGPGWHAAGPLN

47

GGG+ L VLG H L+

2

GGGSTLTVLGCASHTPSNLS

21

19.1%

NZ_PKMC01000001.1:

Lanthipeptides: allorf_0147058_0147204_lanthipeptide

10

HERLLPFFAGCHRGCARVGGGA

31

E L+ F C GC GGG+

2

DEALITSFILCTAGCTSKGGGS

23

19.1%

NZ_SNWQ01000001.1:

Lanthipeptides: EV643_RS00390_lanthipeptide

29

GGAALDVLGPGWHAAGPLN

47

GG+ L VLG G H L+

3

GGSTLTVLGCGSHRPSNLS

21

with 2 more sequence matches

14.9%

NZ_CP039297.1and 4 others:

NZ_CP040672.1 Lanthipeptides: allorf_1096358_1096588_lanthipeptideNZ_CP059318.1 Lanthipeptides: allorf_0101359_0101589_lanthipeptideNZ_CP087137.1 Lanthipeptides: allorf_0101197_0101427_lanthipeptideNZ_CP101913.1 Lanthipeptides: allorf_1819068_1819298_lanthipeptide

Lanthipeptides: allorf_0101424_0101654_lanthipeptide

30

GAALDVLGPGW

40

GA L GPGW

5

GAVLSTRGPGW

15

14.9%

NZ_CP040424.1:

Lanthipeptides: allorf_0710205_0710291_lanthipeptide

9

VHERLLPFFAG

19

+ ERL P FAG

3

LSERLYPLFAG

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

GCM10029976_068560 - Class II: Cleavage pHMM score: -5.00; RODEO score: 0; Monoisotopic mass: 4788.4 Da; Molecular weight: 4791.3 Da; Number of bridges: 1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

BAAHCN010000024.1 - Region 23 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 6,791,999 - 6,814,590 nt. (total: 22,592 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.54	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.54	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for GCM10029976_068770

allorf_6801864_6801995

Leader:

MALLDLQGLETPGYGGGH

Core:

GGGSTLTVLGCASGRPSNLSLLLCH

Core with dehydrations:

GGGDhaDhbLDhbVLGCysADhaGRPDhaNLDhaLLLCysH

antiSMASH-DB 4.0 matches for allorf_6801864_6801995

88.5%

NZ_CP043661.1and 1 other:

NZ_SOCE01000001.1 Lanthipeptides: EV138_RS20105_lanthipeptide

Lanthipeptides: F1D05_RS17325_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSLLLCH

2

GGGSTLTVLGCASHTPSNLSLLLCH

26

88.5%

NZ_SLWN01000005.1:

Lanthipeptides: EV652_RS16625_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGCAS RPSNLSLLLCH

3

GGSTLTVLGCASQRPSNLSLLLCH

26

88.0%

NC_013729.1and 1 other:

NZ_CP114065.1 Lanthipeptides: OX958_RS04450_lanthipeptide

Lanthipeptides: KFLA_RS37165_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC S RPSNLSLLLCH

2

GGSTLTVLGCGSQRPSNLSLLLCH

25

with 72 more sequence matches

Only the first 10 are displayed here.

88.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSL+LCH

1

GGGSTLTVLGCASVTPSNLSLVLCH

25

88.0%

NZ_SHKR01000011.1and 7 others:

NZ_SLWR01000003.1 Lanthipeptides: EV646_RS09945_lanthipeptideNZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGCAS PSNLSLLLCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

85.2%

NZ_JACHWA010000004.1and 1 other:

NZ_PVZV01000008.1 Lanthipeptides: C2865_RS30430_lanthipeptide

Lanthipeptides: FHS43_RS13815_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS +PSNLSLLLCH

3

GGGSTLTVLGCASAKPSNLSLLLCH

27

84.6%

NC_013595.1and 1 other:

NZ_FOQY01000005.1 Lanthipeptides: BM085_RS08660_lanthipeptide

Lanthipeptides: SROS_RS48825_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S +PSNLSLLLCH

2

GGGSTLTVLGCESYKPSNLSLLLCH

26

84.6%

NC_013729.1:

Lanthipeptides: KFLA_RS37060_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S +PSNLSLLLCH

2

GGGSTLTVLGCGSAKPSNLSLLLCH

26

84.6%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGCAS PSNLSL+LCH

2

GGGSTLTVLGCASVTPSNLSLILCH

26

84.6%

NZ_SNWQ01000001.1:

Lanthipeptides: EV643_RS00390_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC S RPSNLSLLLCH

3

GGSTLTVLGCGSHRPSNLSLLLCH

26

81.5%

NZ_JACDUR010000003.1and 1 other:

NZ_JACDUR010000003.1 Lanthipeptides: HNR30_RS17930_lanthipeptide

Lanthipeptides: HNR30_RS17930_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVLGC S PSNLSLLLCH

3

GGGSTLTVLGCNSYTPSNLSLLLCH

27

80.8%

NZ_BBYJ01000032.1and 1 other:

NZ_BBYM01000040.1 Lanthipeptides: AWQ70_RS39425_lanthipeptide

Lanthipeptides: AWQ71_RS42200_lanthipeptide

1

GGGSTLTVLGCASGRPSNLSLLLCH

25

GGGSTLTVL C SGRPSNLS+ LCH

2

GGGSTLTVLTCQSGRPSNLSIALCH

26

80.0%

NZ_JAIWLT010000005.1and 1 other:

NZ_JAIWLU010000020.1 Lanthipeptides: LDL05_RS29535_lanthipeptide

Lanthipeptides: LDL08_RS14700_lanthipeptide

2

GGSTLTVLGCASGRPSNLSLLLCH

25

GGSTLTVLGC SG+PSNLS+ LCH

1

GGSTLTVLGCHSGKPSNLSVALCH

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.15 out of 27.55

Confidence: medium

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.07 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.25 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_6801864_6801995 - Class III

Cleavage pHMM score: 5.70

RODEO score: 0

Monoisotopic mass: 2304.2 Da

Molecular weight: 2305.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2323.7 Da N = 1; 2341.7 Da N = 2; 2359.7 Da N = 3; 2377.7 Da N = 4

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 24 - arylpolyene

Download region GenBank file

Download region SVG

Location: 7,246,246 - 7,287,247 nt. (total: 41,002 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

GCM10029976_073370: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: PPTase aminotransferase methyltransferase

GCM10029976_073450: methyltransferase

smcogs: SMCOG1248: methyltransferase

GCM10029976_073490: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

GCM10029976_073640: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

GCM10029976_073410: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

GCM10029976_073660: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase synthase

GCM10029976_073480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10029976_073520: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10029976_073540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10029976_073550: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10029976_073600: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

GCM10029976_073680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

GCM10029976_073330: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001736.3	0.46	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002536.3	0.46	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0000196.4	0.45	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001075.5	0.45	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.58	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001736.3	0.46	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002536.3	0.46	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0000196.4	0.45	PKS	AQ-256, AQ-270a, AQ-284a	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001075.5	0.45	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.93 out of 20.97

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.24 out of 25.88

Confidence: medium

Additional weak hits (8):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.45 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.58 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.89 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.21 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.14 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.90 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.92 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

GCM10029976_073480: X

AMP-binding (43..377): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VLGLTGMVIK
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10029976_073540: X

AMP-binding (47..428): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALYFT--TK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

GCM10029976_073680: X

AMP-binding (22..408): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --TFNGVVVK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 25 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 7,434,930 - 7,485,123 nt. (total: 50,194 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

GCM10029976_075240: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

GCM10029976_075330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_075470: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

GCM10029976_075480: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acetyltransferase

GCM10029976_075590: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Ligases: synthase

GCM10029976_075420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

GCM10029976_075570: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.34 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.37 out of 20.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.84 out of 36.53

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 29, location 7434929 - 7485123:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_075420: X - mal - X

AMP-binding (43..437): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ALYWVGATAK
Nearest Stachelhaus code(s):: norCMA DPYWWGATFK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

PKS_AT (1134..1403): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.4
Methylmalonyl-CoA: 58.9
Methoxymalonyl-CoA: 58.2
inactive: 39.0
Propionyl-CoA: 36.8
Ethylmalonyl-CoA: 31.7
2-Methylbutyryl-CoA: 26.3
CHC-CoA: 25.7
fatty_acid: 22.5
trans-1,2-CPDA: 21.5
Isobutyryl-CoA: 19.4
Benzoyl-CoA: 15.0
Acetyl-CoA: 9.6
3-Methylbutyryl-CoA: 0.0

AMP-binding (2450..2828): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVHAYAGIIK
Nearest Stachelhaus code(s):: Ala DVWMSAGIIK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

BAAHCN010000024.1 - Region 26 - HR-T2PKS,NRPS

Download region GenBank file

Download region SVG

Location: 8,172,758 - 8,248,815 nt. (total: 76,058 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

GCM10029976_082700: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

GCM10029976_082740: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_082800: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

GCM10029976_082910: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

GCM10029976_083080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

GCM10029976_082730: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase protease

GCM10029976_082650: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

GCM10029976_082880: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

GCM10029976_082780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

GCM10029976_082890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10029976_082920: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

GCM10029976_082930: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

GCM10029976_082980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.83	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001249.5	0.67	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.90 out of 36.53

Confidence: medium

Additional weak hits (18):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.13 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.50 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 27.04

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.53 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.87 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 30, location 8172757 - 8248815:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ser) + (X - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 8172757 - 8215184:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 8189709 - 8248815:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ser) + (X - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

GCM10029976_082730: mal

PKS_AT (6..294): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 65.6
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 42.1
Propionyl-CoA: 31.1
fatty_acid: 26.6
trans-1,2-CPDA: 19.6
inactive: 18.0
CHC-CoA: 10.8
Ethylmalonyl-CoA: 10.7
2-Methylbutyryl-CoA: 9.2
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

GCM10029976_082890: X

AMP-binding (38..365): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SMPSMGSVVK
Nearest Stachelhaus code(s):: diOH-Bz PMPSGGVVNK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

GCM10029976_082920: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (186..604): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DAEDSGLINK
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (82% 8Å match)
Stachelhaus code match:: 70% (weak)

GCM10029976_082930: X

AMP-binding (285..652): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDTLISFGDK
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

GCM10029976_082980: X - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (454..830): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDTLISFGDK
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1489..1871): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

BAAHCN010000024.1 - Region 27 - aminopolycarboxylic-acid

Download region GenBank file

Download region SVG

Location: 9,477,357 - 9,490,741 nt. (total: 13,385 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

GCM10029976_095130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deaminase glucosidase

GCM10029976_095080: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

GCM10029976_095140: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase

GCM10029976_095090: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

GCM10029976_095100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.66	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.56	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002488.3	0.45	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.45	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001843.2	0.43	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000894.4	0.43	other (other)	citrinin	Monascus aurantiacus
BGC0002663.2	0.43	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.66	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.56	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002698.2	0.46	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002488.3	0.45	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.45	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001843.2	0.43	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000894.4	0.43	other (other)	citrinin	Monascus aurantiacus
BGC0002663.2	0.43	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.43 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.01 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.70 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.18 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ZuR variant 1	Zinc-responsive repressor