Streptomyces_albidoflavus_J1074 - 24 region(s)

Download region SVG

Location: 3,011 - 61,711 nt. (total: 58,701 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_0008: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: kinase

XNR_0027: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: esterase

XNR_0016: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

XNR_0019: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

XNR_0021: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_0024: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.90 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.41 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 3010 - 61711:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 3010 - 49139:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 10944 - 61711:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_0021: mal

PKS_AT (1673..1969): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Isobutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.1
Methoxymalonyl-CoA: 58.0
inactive: 54.5
Methylmalonyl-CoA: 53.4
Propionyl-CoA: 42.5
fatty_acid: 29.3
Isobutyryl-CoA: 23.8
Ethylmalonyl-CoA: 21.4
2-Methylbutyryl-CoA: 9.3
trans-1,2-CPDA: 9.2
CHC-CoA: 9.0
Benzoyl-CoA: 9.0
Acetyl-CoA: 7.1
3-Methylbutyryl-CoA: 0.0

XNR_0024: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (459..874): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2554..2933): X

nrpys: Val, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFAGLTFK
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (62% 8Å match); Val DAYFWGVTFK (59% 8Å match); Val or aIle DAYFLGVTFK (59% 8Å match); Ile or Val DAYFWGVTFK (56% 8Å match); Ile DAYFWGVTFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

CP004370.1 - Region 2 - NRPS,T1PKS

Download region SVG

Location: 224,752 - 274,162 nt. (total: 49,411 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

XNR_0200: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

XNR_0201: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

XNR_0202: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

XNR_0203: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

XNR_0207: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: acetyltransferase kinase

XNR_0196: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

XNR_0217: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Ligases: synthase

XNR_0204: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	1.21	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	1.21	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.91	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000996.5	0.90	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001244.3	0.89	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.83	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.75	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.70	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.69	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	0.84	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.84	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.68	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.38 out of 23.43

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.61 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 224751 - 274162:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_0204: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (558..854): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 103.9
Methoxymalonyl-CoA: 96.3
Malonyl-CoA: 91.2
Ethylmalonyl-CoA: 85.2
Propionyl-CoA: 63.6
Isobutyryl-CoA: 60.3
Benzoyl-CoA: 57.0
Acetyl-CoA: 49.4
trans-1,2-CPDA: 48.2
2-Methylbutyryl-CoA: 46.0
fatty_acid: 28.9
CHC-CoA: 27.0
inactive: 21.8
3-Methylbutyryl-CoA: 15.4

AMP-binding (2311..2724): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator

CP004370.1 - Region 3 - terpene

Download region SVG

Location: 308,626 - 335,190 nt. (total: 26,565 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_0270: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

XNR_0277: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

XNR_0264: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

XNR_0278: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

XNR_0269: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.68	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.68	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

XNR_0267: T2TS

Domain 1 (28 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

XNR_0269: PT_FPPS_like

Domain 1 (60 - 354): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

XNR_0271: PT_phytoene_like

Domain 1 (17 - 301): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

XNR_0272: PT_phytoene_like

Domain 1 (17 - 293): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

CP004370.1 - Region 4 - RiPP-like

Download region SVG

Location: 415,688 - 425,903 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

XNR_0345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.46	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.77 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.44 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 27.04

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

CP004370.1 - Region 5 - PKS-like

Download region SVG

Location: 669,953 - 711,002 nt. (total: 41,050 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

XNR_0575: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

XNR_0578: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

XNR_0589: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_0590: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

XNR_0596: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_0602: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acyltransferase aminotransferase glycosyltransferase transferase

XNR_0579: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

XNR_0586: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

XNR_0591: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

XNR_0592: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

XNR_0593: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

XNR_0601: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

XNR_0597: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

XNR_0594: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

XNR_0598: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

XNR_0583: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

XNR_0588: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001732.5	0.88	other (other)	paulomycin	Streptomyces sp. YN86
BGC0001731.5	0.88	other (other)	paulomycin	Streptomyces paulus
BGC0002493.3	0.56	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002474.2	0.56	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001444.5	0.53	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000898.5	0.53	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000791.3	0.52	saccharide	O-antigen	Cronobacter sakazakii
BGC0001850.4	0.51	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001817.5	0.51	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000813.3	0.50	other (other)	K-252a	Nonomuraea longicatena

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001732.5	0.88	other (other)	paulomycin	Streptomyces sp. YN86
BGC0001731.5	0.88	other (other)	paulomycin	Streptomyces paulus
BGC0002493.3	0.56	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002474.2	0.56	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001444.5	0.53	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0000898.5	0.53	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000791.3	0.52	saccharide	O-antigen	Cronobacter sakazakii
BGC0001850.4	0.51	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001817.5	0.51	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000813.3	0.50	other (other)	K-252a	Nonomuraea longicatena

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (16):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.56 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.77 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.32 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.36 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.10 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.93 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.83 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.16 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

XNR_0583: X

AMP-binding (10..380): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GATVVSYPLK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
ZuR variant 1	Zinc-responsive repressor

CP004370.1 - Region 6 - RiPP-like

Download region SVG

Location: 879,961 - 891,289 nt. (total: 11,329 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_0752: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_0759: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

XNR_0754: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.37	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002514.3	0.37	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000204.5	0.36	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002047.2	0.36	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.37	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002514.3	0.37	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000204.5	0.36	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002047.2	0.36	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.03 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.38 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

CP004370.1 - Region 7 - NRPS

Download region SVG

Location: 1,136,316 - 1,199,422 nt. (total: 63,107 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

XNR_0972: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

XNR_0988: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

XNR_1001: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

XNR_0975: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase hydrolase

XNR_0982: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

XNR_0990: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

XNR_0983: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

XNR_0985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease transporter

XNR_0969: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

XNR_0993: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002358.3	0.98	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002358.3	0.98	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.06 out of 23.79

Confidence: medium

Additional weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.14 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.45 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 1136315 - 1199422:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - D-X - Val) + (D-X - Thr - D-Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_0983: Phe - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (258..650): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1303..1691): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGMLVGAVVK
Nearest Stachelhaus code(s):: Thr DGMLVGAIVK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2820..3218): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWLGGTFK
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

XNR_0985: X - Thr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (509..914): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLAESGAVDK
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (76% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2039..2455): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3113..3525): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

CP004370.1 - Region 8 - NI-siderophore

Download region SVG

Location: 1,259,164 - 1,292,196 nt. (total: 33,033 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

XNR_1056: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

XNR_1066: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

XNR_1055: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (12):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.37 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.94 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.07 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

CP004370.1 - Region 9 - terpene

Download region SVG

Location: 1,531,774 - 1,554,059 nt. (total: 22,286 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_1292: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

XNR_1297: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

XNR_1299: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001221.5	0.35	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001387.5	0.33	other (other)	nucleocidin	Streptomyces calvus
BGC0001940.3	0.32	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0001712.3	0.28	other (other)	ochrindole A	Aspergillus steynii IBT 23096
BGC0001215.5	0.28	NRPS	conglobatin	Streptomyces conglobatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000846.5	0.39	other (other)	tabtoxin	Pseudomonas syringae
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001221.5	0.35	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001387.5	0.33	other (other)	nucleocidin	Streptomyces calvus
BGC0001940.3	0.32	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0001712.3	0.28	other (other)	ochrindole A	Aspergillus steynii IBT 23096
BGC0001215.5	0.28	NRPS	conglobatin	Streptomyces conglobatus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

XNR_1297: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (351 - 717): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.12 out of 27.18

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

CP004370.1 - Region 10 - terpene-precursor

Download region SVG

Location: 1,833,804 - 1,854,847 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

XNR_1542: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

XNR_1552: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

XNR_1552: PT_FPPS_like

Domain 1 (61 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 25.58 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.25 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

CP004370.1 - Region 11 - terpene

Download region SVG

Location: 1,865,241 - 1,886,293 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

XNR_1579: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

XNR_1581: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

XNR_1580: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

XNR_1580: T1TS

Domain 1 (2 - 329): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.10 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.14 out of 24.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.17 out of 25.88

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
PsrA	Oleic acid responsive regulator

CP004370.1 - Region 12 - RRE-containing,azole-containing-RiPP

Download region SVG

Location: 2,376,688 - 2,411,371 nt. (total: 34,684 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

XNR_2041: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: amidase hydrolase

XNR_2023: amidase

smcogs: SMCOG1105: amidase

XNR_2026: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: dehydratase

XNR_2033: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Isomerases: mutase

XNR_2045: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.42	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.37	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001146.5	0.37	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001472.5	0.33	ribosomal	berninamycin A	Streptomyces bernensis
BGC0001640.3	0.33	ribosomal	kocurin	Kocuria rosea
BGC0002144.3	0.33	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000569.5	0.32	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001860.4	0.32	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001173.5	0.32	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000628.4	0.32	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.54	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.51	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001146.5	0.51	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000628.4	0.50	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0000613.5	0.49	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001860.4	0.49	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001170.5	0.48	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0001640.3	0.48	ribosomal	kocurin	Kocuria rosea
BGC0001174.4	0.48	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.83 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.71 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.91 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.58 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3
: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.

CP004370.1 - Region 13 - RiPP-like

Download region SVG

Location: 2,560,714 - 2,571,226 nt. (total: 10,513 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0000565.5		0.26	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002504.2		0.19	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000565.5		0.26	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002504.2		0.19	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 27.80 out of 33.73

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.20 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.06 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
HipB	Bacterial antitoxin HipB
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

CP004370.1 - Region 14 - lanthipeptide-class-iii

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 2,713,288 - 2,735,867 nt. (total: 22,580 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_2339: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: hydrolase

XNR_2337: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.65	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.64	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.65	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.64	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for XNR_2332

XNR_2331

Leader:

MALLDLQAMDTPQEEAVGDLAT

Core:

GSQISLLICEYSSLSVTLCTP

Core with dehydrations:

GDhaQIDhaLLICysEYDhaDhaLDhaVDhbLCysDhbP

antiSMASH-DB 4.0 matches for XNR_2331

100.0%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQISLLICEYSSLSVTLCTP

1

GSQISLLICEYSSLSVTLCTP

21

95.2%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSVTLCTP

1

GSQVSLLICEYSSLSVTLCTP

21

90.5%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSVTLCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

with 70 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSV LCTP

1

GSQVSLLICEYSSLSVVLCTP

21

90.5%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLSVTLCTP

1

GSQVSLLICEFSSLSVTLCTP

21

85.7%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

85.7%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLS+TLCTP

1

GSQVSLLICEHSSLSLTLCTP

21

81.0%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

81.0%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLS+TLCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

81.0%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLSV LCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

81.0%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+S+L+CEYSSLSV LCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

76.2%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SL++CEYSSLS LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

66.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQISLLICEYSSLSVTLCT

20

GSQ SLL+C SSLSVT C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for XNR_2331

81.8%

Lanthipeptide: SRO15-2212

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (6):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.71 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.13 out of 29.25

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

XNR_2331 - Class III

Cleavage pHMM score: 30.10

RODEO score: 0

Monoisotopic mass: 2087.1 Da

Molecular weight: 2088.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2106.4 Da N = 1; 2124.5 Da N = 2; 2142.5 Da N = 3; 2160.5 Da N = 4; 2178.5 Da N = 5

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

CP004370.1 - Region 15 - NRPS

Download region SVG

Location: 3,553,726 - 3,604,015 nt. (total: 50,290 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

XNR_3144: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.28 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.05 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.47 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 3553725 - 3604015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_3144: X - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DADEAGYVDK
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1523..1921): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DADEAGLVDK
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (76% 8Å match); Lys DADDAGTVDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2582..2976): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DADEAGLVDK
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (68% 8Å match); Lys DADDAGTVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

CP004370.1 - Region 16 - NRPS,azole-containing-RiPP

Download region SVG

Location: 3,877,105 - 3,985,758 nt. (total: 108,654 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_3458: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acyltransferase

XNR_3448: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

XNR_3449: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: hydrolase

XNR_3450: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

XNR_3457: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

XNR_3446: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

XNR_3447: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	1.09	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.43	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.40	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.39	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.38	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	0.98	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.16 out of 23.43

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.15 out of 23.79

Confidence: medium

Additional weak hits (21):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.17 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.30 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.90 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.81 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.30 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.31 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.02 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.25 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.66 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.82 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.27 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.49 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 18, location 3877104 - 3985758:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (X - D-Phe - D-Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 19, location 3877104 - 3982798:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (X - D-Phe - D-Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_3446: X - Phe - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (504..890): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFWGVTFK
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (100% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1536..1941): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3081..3478): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALLFGAVVK
Nearest Stachelhaus code(s):: Leu DALLFGAVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

XNR_3447: Ile - Leu - Val - Ala - Val - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (525..926): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTTVSLADK
Nearest Stachelhaus code(s):: Ile LDTTVSLADK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1587..1964): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMLAGAVAK
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3090..3479): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYWWGGTFK
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4139..4509): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVF-VAIVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5635..6026): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYWWGGTFK
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6685..7058): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAIVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

XNR_3448: Trp - Leu - Val - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (43..432): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVAMVGAVCK
Nearest Stachelhaus code(s):: Trp DVAMVGAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1106..1482): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAMLAGAVAK
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2623..3011): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYWWGGTFK
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3661..4073): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

XNR_3449: Ile - Ala - Ile - X - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (19..406): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFWGVTFK
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (100% 8Å match); Ile or aIle DAYFWGVTFK (91% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1057..1430): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAIVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2566..2959): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFWGVTFK
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (100% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3623..4009): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFWGVTFK
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (100% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5134..5544): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: DVSDAGGVEK
Nearest Stachelhaus code(s):: Lys DVSDAGGVEK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 18 - 113; Score: 69.1; RRE type: NHLP_CD_RRE; Location: 18 - 110; Score: 47.2; RRE type: Cyanobactin_D_RRE; Location: 18 - 94; Score: 34.8

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

Core peptide predictions

No core peptides found.

CP004370.1 - Region 17 - NRPS

Download region SVG

Location: 4,469,477 - 4,513,826 nt. (total: 44,350 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

XNR_3950: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_3955: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: esterase hydrolase

XNR_3942: putative esterase

smcogs: SMCOG1104: putative esterase

XNR_3964: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: lyase

XNR_3948: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

XNR_3949: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

XNR_3944: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

XNR_3951: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

XNR_3959: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.00 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.74 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.18 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.47 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.58 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.31 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 4469476 - 4513826:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_3951: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (6..417): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKLGHVGK
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (71% 8Å match); OH-Asp DLTKVGHVGK (68% 8Å match); Asn DLTKLGEVGK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

CP004370.1 - Region 18 - NI-siderophore

Download region SVG

Location: 4,731,450 - 4,761,270 nt. (total: 29,821 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

XNR_4189: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

XNR_4195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: decarboxylase

XNR_4190: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Translocases: transporter

XNR_4173: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.65 out of 23.43

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

Additional weak hits (16):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.00 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.75 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.68 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.57 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.36 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.57 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.87 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.08 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.06 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism

CP004370.1 - Region 19 - ectoine

Download region SVG

Location: 5,635,346 - 5,645,744 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

XNR_4958: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

XNR_4956: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

XNR_4961: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

XNR_4963: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (10):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.04 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.25 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

CP004370.1 - Region 20 - NRPS-like

Download region SVG

Location: 6,337,383 - 6,381,213 nt. (total: 43,831 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

XNR_5623: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

XNR_5637: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

XNR_5640: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

XNR_5615: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

XNR_5633: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: decarboxylase

XNR_5626: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.64	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.64	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

Additional weak hits (16):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.64 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.69 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.37 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.94 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 6337382 - 6381213:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_5634: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (20..420): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLINK
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

CP004370.1 - Region 21 - RiPP-like,terpene

Download region SVG

Location: 6,400,041 - 6,430,092 nt. (total: 30,052 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

XNR_5676: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

XNR_5684: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

XNR_5691: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

XNR_5704: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase synthetase

XNR_5683: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

XNR_5697: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.51	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.30	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.29	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.28	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000644.3	0.26	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.25	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.72	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.64	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.50	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

XNR_5683: PT_FPPS_like

Domain 1 (72 - 368): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

XNR_5685: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

XNR_5692: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.48 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.02 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.08 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.87 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.26 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.17 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.02 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.20 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

CP004370.1 - Region 22 - RiPP-like

Download region SVG

Location: 6,501,767 - 6,513,134 nt. (total: 11,368 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.95	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.44	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002699.2	0.44	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.42	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.95	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.44	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002699.2	0.44	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000554.4	0.42	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.61 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.90 out of 20.97

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

CP004370.1 - Region 23 - T3PKS

Download region SVG

Location: 6,520,374 - 6,561,471 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

XNR_5803: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

XNR_5806: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_5809: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

XNR_5817: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

XNR_5818: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

XNR_5819: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: synthase

XNR_5808: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.63	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001377.5	0.47	PKS	uncialamycin	Streptomyces uncialis
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.63	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001377.5	0.47	PKS	uncialamycin	Streptomyces uncialis
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

Additional weak hits (14):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.84 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.66 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.14 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.02 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.58 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.36 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.06 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.35 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.72 out of 30.98

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

CP004370.1 - Region 24 - NRPS,NRPS-like,T1PKS,lanthipeptide-class-ii,terpene-precursor

Download region SVG

Location: 6,566,423 - 6,838,639 nt. (total: 272,217 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

XNR_5845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_5865: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

XNR_5881: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_5889: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

XNR_5911: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_5917: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

XNR_5931: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acetyltransferase acylase acyltransferase aminotransferase formyltransferase glycosyltransferase halogenase

XNR_5857: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

XNR_5858: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

XNR_5861: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

XNR_5866: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

XNR_5867: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

XNR_5891: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

XNR_5914: halogenase

smcogs: SMCOG1119: halogenase

XNR_5916: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: esterase protease

XNR_5863: thioesterase

smcogs: SMCOG1004: thioesterase

XNR_5908: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

XNR_5923: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase dehydratase

XNR_5853: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

XNR_5897: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Isomerases: isomerase

XNR_5862: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

XNR_5847: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

XNR_5854: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5856: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5888: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

XNR_5890: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5892: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

XNR_5895: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5918: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

XNR_5920: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000958.5	2.08	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001273.3	1.95	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	1.94	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	1.91	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	1.80	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.79	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	1.75	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	1.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	1.75	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	1.74	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000034.5	0.97	NRPS, PKS	candicidin	Streptomyces sp. FR-008
BGC0000958.5	0.94	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.83	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001455.6	0.77	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for XNR_5897

allorf_6768184_6768369

Leader:

MGDGGTWGSGPHLSWRARRAPGG

Core:

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

Core with dehydrations:

RAGDhbARPHPRAAGHVHRRAADhbQVRGCysRCysARALDhbRVDhaGP

antiSMASH-DB 4.0 matches for allorf_6768184_6768369

100.0%

NC_020990.1and 1 other:

NC_020990.1 Lanthipeptides: allorf_6768184_6768369_lanthipeptide

Lanthipeptides: allorf_6768184_6768369_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NZ_CM002273.1and 3 others:

NZ_CM002273.1 Lanthipeptides: allorf_6788528_6788713_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptide

Lanthipeptides: allorf_6788528_6788713_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NZ_CP113103.1and 1 other:

NZ_CP113103.1 Lanthipeptides: allorf_0072598_0072783_lanthipeptide

Lanthipeptides: allorf_0072598_0072783_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPH RAAGHVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHLRAAGHVHRRAATQVRGCRCARALTRVSGP

38

with 10 more sequence matches

89.5%

NZ_MNPQ01000024.1and 1 other:

NZ_MNPQ01000024.1 Lanthipeptides: allorf_033269_033448_lanthipeptide

Lanthipeptides: allorf_033269_033448_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTA PRAAGH+HRRAATQVRGCRCARALTRVSGP

1

RAGTA--SPRAAGHLHRRAATQVRGCRCARALTRVSGP

36

60.5%

NZ_CP026490.1:

Lanthipeptides: allorf_0208403_0208621_lanthipeptide

5

ARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA HV RA TQV +C +ALTRVSGP

5

ARPYPRAARHVRLRATTQVPVRQCPKALTRVSGP

38

57.9%

NZ_CP076385.1:

Lanthipeptides: allorf_6932531_6932749_lanthipeptide

5

ARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA HV A TQV +C +ALTRVSGP

5

ARPYPRAARHVRLPATTQVPVRQCPKALTRVSGP

38

50.0%

NZ_CP009802.1and 1 other:

NZ_CP009802.1 Lanthipeptides: allorf_7024728_7024922_lanthipeptide

Lanthipeptides: allorf_7024728_7024922_lanthipeptide

20

ATQVRGCRCARALTRVSGP

38

ATQVRGCRCARALTRVSGP

1

ATQVRGCRCARALTRVSGP

19

31.6%

NZ_WKYV01000009.1:

Lanthipeptides: GKG41_RS09335_lanthipeptide

10

RAAGHVHRRAATQVRGC-RCARALTRVS

36

AA +V A TQVR C RC + V+

4

NAAANVPSPAVTQVRTCTRCTSSYVGVA

31

26.3%

NZ_CP012109.1:

Lanthipeptides: A176_RS40855_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCR

27

RAG + A G V RA+ GC

4

RAGGSDSASVAGGSVSSRASDSDVGCD

30

15.8%

NZ_CP061274.1:

Lanthipeptides: allorf_2084980_2085063_lanthipeptide

16

HRRAATQVRGC

26

HRR ++RGC

7

HRRLGGEMRGC

17

15.2%

NZ_CP041244.1:

Lanthipeptides: allorf_9024962_9025201_lanthipeptide

7

PHPRAAGH

14

P PRAAGH

27

PEPRAAGH

34

14.5%

NZ_CP067395.1and 1 other:

NZ_CP072597.1 Lanthipeptides: J5226_RS17500_lanthipeptide

Lanthipeptides: JHW38_RS03590_lanthipeptide

19

AATQVRGCRCARALTRVSG

37

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAG

24

14.5%

NZ_FNOG01000005.1:

Lanthipeptides: BLU84_RS14530_lanthipeptide

19

AATQVRGCRCARALTRVSGP

38

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAGD

25

Lanthipeptide(s) for XNR_5901

allorf_6768184_6768369

Leader:

MGDGGTWGSGPHLSWRARRAPGG

Core:

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

Core with dehydrations:

RAGDhbARPHPRAAGHVHRRAADhbQVRGCysRCysARALDhbRVDhaGP

antiSMASH-DB 4.0 matches for allorf_6768184_6768369

100.0%

NC_020990.1and 1 other:

NC_020990.1 Lanthipeptides: allorf_6768184_6768369_lanthipeptide

Lanthipeptides: allorf_6768184_6768369_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NZ_CM002273.1and 3 others:

NZ_CM002273.1 Lanthipeptides: allorf_6788528_6788713_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptide

Lanthipeptides: allorf_6788528_6788713_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NZ_CP113103.1and 1 other:

NZ_CP113103.1 Lanthipeptides: allorf_0072598_0072783_lanthipeptide

Lanthipeptides: allorf_0072598_0072783_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPH RAAGHVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHLRAAGHVHRRAATQVRGCRCARALTRVSGP

38

with 10 more sequence matches

89.5%

NZ_MNPQ01000024.1and 1 other:

NZ_MNPQ01000024.1 Lanthipeptides: allorf_033269_033448_lanthipeptide

Lanthipeptides: allorf_033269_033448_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

RAGTA PRAAGH+HRRAATQVRGCRCARALTRVSGP

1

RAGTA--SPRAAGHLHRRAATQVRGCRCARALTRVSGP

36

60.5%

NZ_CP026490.1:

Lanthipeptides: allorf_0208403_0208621_lanthipeptide

5

ARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA HV RA TQV +C +ALTRVSGP

5

ARPYPRAARHVRLRATTQVPVRQCPKALTRVSGP

38

57.9%

NZ_CP076385.1:

Lanthipeptides: allorf_6932531_6932749_lanthipeptide

5

ARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA HV A TQV +C +ALTRVSGP

5

ARPYPRAARHVRLPATTQVPVRQCPKALTRVSGP

38

50.0%

NZ_CP009802.1and 1 other:

NZ_CP009802.1 Lanthipeptides: allorf_7024728_7024922_lanthipeptide

Lanthipeptides: allorf_7024728_7024922_lanthipeptide

20

ATQVRGCRCARALTRVSGP

38

ATQVRGCRCARALTRVSGP

1

ATQVRGCRCARALTRVSGP

19

31.6%

NZ_WKYV01000009.1:

Lanthipeptides: GKG41_RS09335_lanthipeptide

10

RAAGHVHRRAATQVRGC-RCARALTRVS

36

AA +V A TQVR C RC + V+

4

NAAANVPSPAVTQVRTCTRCTSSYVGVA

31

26.3%

NZ_CP012109.1:

Lanthipeptides: A176_RS40855_lanthipeptide

1

RAGTARPHPRAAGHVHRRAATQVRGCR

27

RAG + A G V RA+ GC

4

RAGGSDSASVAGGSVSSRASDSDVGCD

30

15.8%

NZ_CP061274.1:

Lanthipeptides: allorf_2084980_2085063_lanthipeptide

16

HRRAATQVRGC

26

HRR ++RGC

7

HRRLGGEMRGC

17

15.2%

NZ_CP041244.1:

Lanthipeptides: allorf_9024962_9025201_lanthipeptide

7

PHPRAAGH

14

P PRAAGH

27

PEPRAAGH

34

14.5%

NZ_CP067395.1and 1 other:

NZ_CP072597.1 Lanthipeptides: J5226_RS17500_lanthipeptide

Lanthipeptides: JHW38_RS03590_lanthipeptide

19

AATQVRGCRCARALTRVSG

37

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAG

24

14.5%

NZ_FNOG01000005.1:

Lanthipeptides: BLU84_RS14530_lanthipeptide

19

AATQVRGCRCARALTRVSGP

38

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAGD

25

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

XNR_5847: PT_FPPS_like

Domain 1 (80 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.29 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.49 out of 30.12

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.90 out of 26.85

Confidence: medium

Additional weak hits (21):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.40 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.58 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.11 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.77 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.63 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.08 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.49 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

allorf_6768184_6768369 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3984.2 Da

Molecular weight: 3986.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4004.6 Da N = 1; 4022.6 Da N = 2

allorf_6768184_6768369 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3984.2 Da

Molecular weight: 3986.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4004.6 Da N = 1; 4022.6 Da N = 2

Predicted core structure(s)

For candidate cluster 29, location 6566422 - 6838639:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal) + (mal) + (Thr - fatty_acid) + (Acetyl-CoA - mal - Pro) + (Gly - ccmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 6566422 - 6721645:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 6720235 - 6786581:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - mal - Pro) + (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 34, location 6774320 - 6838639:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - ccmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

XNR_5854: mal - mal - pk - mal - mal - mal

PKS_AT (557..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.4
inactive: 93.0
Methoxymalonyl-CoA: 52.8
Methylmalonyl-CoA: 43.3
Isobutyryl-CoA: 26.4
Propionyl-CoA: 25.5
Ethylmalonyl-CoA: 20.5
Benzoyl-CoA: 20.2
Acetyl-CoA: 17.4
2-Methylbutyryl-CoA: 16.3
CHC-CoA: 13.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2312..2619): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.9
inactive: 103.3
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 45.5
Propionyl-CoA: 34.7
Acetyl-CoA: 21.2
Isobutyryl-CoA: 20.3
Benzoyl-CoA: 16.9
2-Methylbutyryl-CoA: 16.4
fatty_acid: 7.4
CHC-CoA: 7.3
Ethylmalonyl-CoA: 6.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3871..4168): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 224.9
Methylmalonyl-CoA: 223.8
Methoxymalonyl-CoA: 181.4
2-Methylbutyryl-CoA: 163.1
trans-1,2-CPDA: 134.0
Propionyl-CoA: 118.2
CHC-CoA: 117.5
Malonyl-CoA: 109.9
Isobutyryl-CoA: 84.8
Benzoyl-CoA: 67.1
Acetyl-CoA: 52.7
3-Methylbutyryl-CoA: 37.3
inactive: 32.4
fatty_acid: 31.4

PKS_AT (5407..5713): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.1
inactive: 112.2
Methoxymalonyl-CoA: 61.9
Methylmalonyl-CoA: 54.9
Propionyl-CoA: 21.6
Isobutyryl-CoA: 16.8
Ethylmalonyl-CoA: 13.8
Acetyl-CoA: 13.6
Benzoyl-CoA: 10.6
fatty_acid: 9.6
CHC-CoA: 9.0
3-Methylbutyryl-CoA: 6.6
trans-1,2-CPDA: 3.5
2-Methylbutyryl-CoA: -0.2

PKS_AT (6933..7232): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.6
inactive: 116.9
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 26.8
Benzoyl-CoA: 22.0
Isobutyryl-CoA: 20.2
Acetyl-CoA: 19.6
Ethylmalonyl-CoA: 15.5
fatty_acid: 15.2
CHC-CoA: 13.8
2-Methylbutyryl-CoA: 13.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8462..8763): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.8
inactive: 103.6
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 59.3
Isobutyryl-CoA: 29.0
Ethylmalonyl-CoA: 26.8
Propionyl-CoA: 26.2
Benzoyl-CoA: 19.7
Acetyl-CoA: 18.3
fatty_acid: 17.7
CHC-CoA: 16.8
2-Methylbutyryl-CoA: 11.6
trans-1,2-CPDA: 11.4
3-Methylbutyryl-CoA: 0.0

XNR_5855: mal - mal - mal - mal

PKS_AT (550..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.9
inactive: 116.1
Methoxymalonyl-CoA: 63.1
Methylmalonyl-CoA: 56.5
Isobutyryl-CoA: 27.3
Propionyl-CoA: 24.2
Benzoyl-CoA: 22.9
Acetyl-CoA: 21.2
Ethylmalonyl-CoA: 14.7
fatty_acid: 11.4
2-Methylbutyryl-CoA: 8.7
CHC-CoA: 8.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2592..2891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.4
inactive: 94.9
Methoxymalonyl-CoA: 63.6
Methylmalonyl-CoA: 52.7
Benzoyl-CoA: 23.4
Isobutyryl-CoA: 21.3
Ethylmalonyl-CoA: 20.8
fatty_acid: 19.3
Acetyl-CoA: 18.7
Propionyl-CoA: 18.1
CHC-CoA: 13.6
2-Methylbutyryl-CoA: 9.7
trans-1,2-CPDA: 7.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (4635..4931): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.8
inactive: 115.5
Methoxymalonyl-CoA: 69.4
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 37.0
Isobutyryl-CoA: 28.6
Ethylmalonyl-CoA: 23.0
Benzoyl-CoA: 22.7
fatty_acid: 20.8
Acetyl-CoA: 19.9
CHC-CoA: 17.3
2-Methylbutyryl-CoA: 16.9
trans-1,2-CPDA: 10.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (6164..6462): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.5
inactive: 109.3
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 55.4
Propionyl-CoA: 25.5
CHC-CoA: 22.1
Acetyl-CoA: 21.0
2-Methylbutyryl-CoA: 20.3
Benzoyl-CoA: 20.2
Ethylmalonyl-CoA: 19.7
Isobutyryl-CoA: 16.8
fatty_acid: 16.0
trans-1,2-CPDA: 9.6
3-Methylbutyryl-CoA: 0.0

XNR_5856: mal

PKS_AT (547..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.7
inactive: 117.2
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 54.2
Propionyl-CoA: 23.9
Isobutyryl-CoA: 21.1
Benzoyl-CoA: 18.1
Acetyl-CoA: 17.1
fatty_acid: 12.2
Ethylmalonyl-CoA: 9.2
CHC-CoA: 8.2
2-Methylbutyryl-CoA: 4.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

XNR_5857: mmal - mmal - mmal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.1
Ethylmalonyl-CoA: 215.8
Methoxymalonyl-CoA: 171.3
2-Methylbutyryl-CoA: 158.2
trans-1,2-CPDA: 129.4
Propionyl-CoA: 119.5
Malonyl-CoA: 98.4
CHC-CoA: 95.7
Isobutyryl-CoA: 72.1
Benzoyl-CoA: 67.8
Acetyl-CoA: 54.2
fatty_acid: 47.0
inactive: 36.3
3-Methylbutyryl-CoA: 36.0

PKS_AT (2141..2438): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.1
Ethylmalonyl-CoA: 215.8
Methoxymalonyl-CoA: 171.3
2-Methylbutyryl-CoA: 158.2
trans-1,2-CPDA: 129.4
Propionyl-CoA: 119.5
Malonyl-CoA: 98.4
CHC-CoA: 95.7
Isobutyryl-CoA: 72.1
Benzoyl-CoA: 67.8
Acetyl-CoA: 54.2
fatty_acid: 47.0
inactive: 36.3
3-Methylbutyryl-CoA: 36.0

PKS_AT (4248..4545): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.1
Ethylmalonyl-CoA: 202.9
Methoxymalonyl-CoA: 169.3
2-Methylbutyryl-CoA: 131.7
trans-1,2-CPDA: 129.8
Propionyl-CoA: 108.2
Malonyl-CoA: 103.0
CHC-CoA: 98.2
Isobutyryl-CoA: 71.5
Benzoyl-CoA: 57.5
Acetyl-CoA: 41.0
inactive: 38.2
fatty_acid: 30.1
3-Methylbutyryl-CoA: 28.7

XNR_5858: mal - mal - mal - mal - mal - mal

PKS_AT (578..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.6
inactive: 103.9
Methoxymalonyl-CoA: 54.5
Methylmalonyl-CoA: 46.8
Propionyl-CoA: 27.1
Isobutyryl-CoA: 17.9
Acetyl-CoA: 17.1
Ethylmalonyl-CoA: 15.5
Benzoyl-CoA: 15.2
2-Methylbutyryl-CoA: 13.1
fatty_acid: 11.7
CHC-CoA: 3.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2320..2612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.5
inactive: 114.0
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 50.7
Propionyl-CoA: 30.5
Isobutyryl-CoA: 26.3
Acetyl-CoA: 24.1
Benzoyl-CoA: 21.8
2-Methylbutyryl-CoA: 14.2
Ethylmalonyl-CoA: 13.3
fatty_acid: 7.7
3-Methylbutyryl-CoA: 4.3
CHC-CoA: 0.7
trans-1,2-CPDA: 0.0

PKS_AT (4061..4351): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.1
inactive: 99.7
Methoxymalonyl-CoA: 52.2
Methylmalonyl-CoA: 47.4
Acetyl-CoA: 26.2
Propionyl-CoA: 21.9
Benzoyl-CoA: 13.9
Isobutyryl-CoA: 12.0
2-Methylbutyryl-CoA: 10.0
Ethylmalonyl-CoA: 9.9
CHC-CoA: 9.2
fatty_acid: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5777..6069): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.5
inactive: 111.7
Methoxymalonyl-CoA: 54.8
Methylmalonyl-CoA: 54.0
Propionyl-CoA: 31.4
Acetyl-CoA: 24.0
Ethylmalonyl-CoA: 19.0
Benzoyl-CoA: 18.6
trans-1,2-CPDA: 18.0
Isobutyryl-CoA: 17.6
fatty_acid: 13.1
2-Methylbutyryl-CoA: 12.3
CHC-CoA: 3.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (7492..7783): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 217.2
inactive: 93.3
Methoxymalonyl-CoA: 56.7
Methylmalonyl-CoA: 47.4
Propionyl-CoA: 30.8
Acetyl-CoA: 20.1
Isobutyryl-CoA: 17.3
Ethylmalonyl-CoA: 15.7
Benzoyl-CoA: 12.5
trans-1,2-CPDA: 10.0
2-Methylbutyryl-CoA: 9.7
fatty_acid: 7.9
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (9332..9621): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.5
inactive: 89.0
Methoxymalonyl-CoA: 40.7
Methylmalonyl-CoA: 40.0
Propionyl-CoA: 29.0
Acetyl-CoA: 25.1
Ethylmalonyl-CoA: 16.8
Isobutyryl-CoA: 9.8
Benzoyl-CoA: 9.8
2-Methylbutyryl-CoA: 6.6
CHC-CoA: 2.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

XNR_5861: X - mal

AMP-binding (30..440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --QVLAVNGK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1204..1498): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.8
inactive: 90.1
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 48.8
Ethylmalonyl-CoA: 32.4
Acetyl-CoA: 31.3
Propionyl-CoA: 30.1
2-Methylbutyryl-CoA: 23.2
Benzoyl-CoA: 20.3
fatty_acid: 19.8
CHC-CoA: 11.2
trans-1,2-CPDA: 11.0
3-Methylbutyryl-CoA: 7.4

XNR_5888: X

AMP-binding (7..402): X

nrpys: Pyv, Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVWLGVGFK
Nearest Stachelhaus code(s):: Pyv or Ant GSVWLGVGFK (100% 8Å match); Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

XNR_5890: mal

PKS_AT (543..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
inactive: 68.7
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 39.2
Ethylmalonyl-CoA: 23.7
Propionyl-CoA: 23.3
Isobutyryl-CoA: 15.1
Benzoyl-CoA: 13.3
Acetyl-CoA: 10.3
fatty_acid: 9.4
2-Methylbutyryl-CoA: 3.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

XNR_5891: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..875): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1710..2121): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.7
Acetyl-CoA: 13.5
AHBA: 6.5
NH2: 1.5
shikimic_acid: 0.0

XNR_5895: Acetyl-CoA - mal - Pro

Search NORINE for peptide: strict or relaxed

CAL_domain (54..488): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 22.6
AHBA: 16.1
fatty_acid: 14.9
NH2: 10.7
shikimic_acid: 0.0

PKS_AT (1197..1479): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 104.7
inactive: 54.3
Methylmalonyl-CoA: 49.2
Methoxymalonyl-CoA: 40.8
Propionyl-CoA: 35.7
fatty_acid: 27.8
Ethylmalonyl-CoA: 20.9
CHC-CoA: 20.0
2-Methylbutyryl-CoA: 19.9
Benzoyl-CoA: 15.9
trans-1,2-CPDA: 15.7
Isobutyryl-CoA: 12.5
3-Methylbutyryl-CoA: 8.6
Acetyl-CoA: 7.4

AMP-binding (2584..2978): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFYAQVIK
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

XNR_5916: Gly - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (567..948): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (2709..2998): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.4
inactive: 71.1
Methylmalonyl-CoA: 56.2
Methoxymalonyl-CoA: 55.5
Propionyl-CoA: 28.2
Ethylmalonyl-CoA: 26.3
Isobutyryl-CoA: 24.6
Benzoyl-CoA: 17.1
fatty_acid: 15.8
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 8.0
trans-1,2-CPDA: 4.8
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

XNR_5918: mal

PKS_AT (1673..1969): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Isobutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.1
Methoxymalonyl-CoA: 58.0
inactive: 54.5
Methylmalonyl-CoA: 53.4
Propionyl-CoA: 42.5
fatty_acid: 29.3
Isobutyryl-CoA: 23.8
Ethylmalonyl-CoA: 21.4
2-Methylbutyryl-CoA: 9.3
trans-1,2-CPDA: 9.2
CHC-CoA: 9.0
Benzoyl-CoA: 9.0
Acetyl-CoA: 7.1
3-Methylbutyryl-CoA: 0.0