Streptomyces_albogriseolus_NPDC031026 - 24 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NPDC031026.ctg-0003 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	RiPP-like	37,936	49,249
Region 3.2	terpene	72,309	94,465	High	geosmin	terpene:Sesquiterpene
Region 3.3	NI-siderophore	227,258	258,432

NPDC031026.ctg-0004 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	NRPS,RiPP-like	85,804	164,390	Medium	informatipeptin	ribosomal:RiPP:Lanthipeptide

NPDC031026.ctg-0005 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	azole-containing-RiPP	168,097	190,614	High	streptamidine	ribosomal:unmodified

NPDC031026.ctg-0007 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	RRE-containing	111,379	131,900

NPDC031026.ctg-0008 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NI-siderophore	185,154	214,926	High	desferrioxamin B/desferrioxamine E	other:other

NPDC031026.ctg-0013 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	T2PKS	1	47,670	High	spore pigment	PKS

NPDC031026.ctg-0015 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	thioamitides	49,636	72,172
Region 15.2	CDPS	77,061	97,780

NPDC031026.ctg-0016 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	lassopeptide	54,059	76,552	High	aborycin	ribosomal:RiPP

NPDC031026.ctg-0018 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	ectoine	83,521	93,919	High	ectoine	other:other

NPDC031026.ctg-0023 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	lanthipeptide-class-i,NRPS,lanthipeptide-class-ii,NRPS-like,T1PKS	13,245	118,477	Low	streptovaricin	PKS

NPDC031026.ctg-0026 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	T1PKS,T2PKS,butyrolactone	1	105,206	Medium	naphthomycin A	PKS

NPDC031026.ctg-0027 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	NRPS	1	40,019	High	arylomycin	NRPS:Type I

NPDC031026.ctg-0034 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	terpene	1	19,141	Medium	hopene	terpene

NPDC031026.ctg-0035 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	NRPS,T1PKS	1	70,443	Low	aurantimycin A	NRPS:Type I+PKS

NPDC031026.ctg-0036 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	NRPS,T1PKS	1	50,077	High	antimycin A1B	NRPS:Type I+PKS

NPDC031026.ctg-0037 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 37.1	T1PKS,NRPS	1	46,230	Medium	incarnatapeptin A/incarnatapeptin B/dentigerumycin F/dentigerumycin G	PKS+NRPS:Type I

NPDC031026.ctg-0039 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 39.1	terpene-precursor	1,479	22,600
Region 39.2	terpene	24,928	45,941	High	albaflavenone	terpene

NPDC031026.ctg-0044 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	lassopeptide,NRPS	7,649	38,979	Low	humidimycin	ribosomal:RiPP

NPDC031026.ctg-0046 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	lanthipeptide-class-i	1	22,185

NPDC031026.ctg-0056 (Streptomyces albogriseolus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 56.1	T1PKS	1	13,786

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	RiPP-like	37,936	49,249
Region 3.2	terpene	72,309	94,465	High	geosmin	terpene:Sesquiterpene
Region 3.3	NI-siderophore	227,258	258,432
Region 4.1	NRPS,RiPP-like	85,804	164,390	Medium	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 5.1	azole-containing-RiPP	168,097	190,614	High	streptamidine	ribosomal:unmodified
Region 7.1	RRE-containing	111,379	131,900
Region 8.1	NI-siderophore	185,154	214,926	High	desferrioxamin B/desferrioxamine E	other:other
Region 13.1	T2PKS	1	47,670	High	spore pigment	PKS
Region 15.1	thioamitides	49,636	72,172
Region 15.2	CDPS	77,061	97,780
Region 16.1	lassopeptide	54,059	76,552	High	aborycin	ribosomal:RiPP
Region 18.1	ectoine	83,521	93,919	High	ectoine	other:other
Region 23.1	lanthipeptide-class-i,NRPS,lanthipeptide-class-ii,NRPS-like,T1PKS	13,245	118,477	Low	streptovaricin	PKS
Region 26.1	T1PKS,T2PKS,butyrolactone	1	105,206	Medium	naphthomycin A	PKS
Region 27.1	NRPS	1	40,019	High	arylomycin	NRPS:Type I
Region 34.1	terpene	1	19,141	Medium	hopene	terpene
Region 35.1	NRPS,T1PKS	1	70,443	Low	aurantimycin A	NRPS:Type I+PKS
Region 36.1	NRPS,T1PKS	1	50,077	High	antimycin A1B	NRPS:Type I+PKS
Region 37.1	T1PKS,NRPS	1	46,230	Medium	incarnatapeptin A/incarnatapeptin B/dentigerumycin F/dentigerumycin G	PKS+NRPS:Type I
Region 39.1	terpene-precursor	1,479	22,600
Region 39.2	terpene	24,928	45,941	High	albaflavenone	terpene
Region 44.1	lassopeptide,NRPS	7,649	38,979	Low	humidimycin	ribosomal:RiPP
Region 46.1	lanthipeptide-class-i	1	22,185
Region 56.1	T1PKS	1	13,786

No secondary metabolite regions were found in these records:: NPDC031026.ctg-0001 (Streptomyces albogriseolus); NPDC031026.ctg-0002 (Streptomyces albogriseolus); NPDC031026.ctg-0006 (Streptomyces albogriseolus); NPDC031026.ctg-0009 (Streptomyces albogriseolus); NPDC031026.ctg-0010 (Streptomyces albogriseolus); NPDC031026.ctg-0011 (Streptomyces albogriseolus); NPDC031026.ctg-0012 (Streptomyces albogriseolus); NPDC031026.ctg-0014 (Streptomyces albogriseolus); NPDC031026.ctg-0017 (Streptomyces albogriseolus); NPDC031026.ctg-0019 (Streptomyces albogriseolus); NPDC031026.ctg-0020 (Streptomyces albogriseolus); NPDC031026.ctg-0021 (Streptomyces albogriseolus); NPDC031026.ctg-0022 (Streptomyces albogriseolus); NPDC031026.ctg-0024 (Streptomyces albogriseolus); NPDC031026.ctg-0025 (Streptomyces albogriseolus); NPDC031026.ctg-0028 (Streptomyces albogriseolus); NPDC031026.ctg-0029 (Streptomyces albogriseolus); NPDC031026.ctg-0030 (Streptomyces albogriseolus); NPDC031026.ctg-0031 (Streptomyces albogriseolus); NPDC031026.ctg-0032 (Streptomyces albogriseolus); NPDC031026.ctg-0033 (Streptomyces albogriseolus); NPDC031026.ctg-0038 (Streptomyces albogriseolus); NPDC031026.ctg-0040 (Streptomyces albogriseolus); NPDC031026.ctg-0041 (Streptomyces albogriseolus); NPDC031026.ctg-0042 (Streptomyces albogriseolus); NPDC031026.ctg-0043 (Streptomyces albogriseolus); NPDC031026.ctg-0045 (Streptomyces albogriseolus); NPDC031026.ctg-0047 (Streptomyces albogriseolus); NPDC031026.ctg-0048 (Streptomyces albogriseolus); NPDC031026.ctg-0049 (Streptomyces albogriseolus); NPDC031026.ctg-0050 (Streptomyces albogriseolus); NPDC031026.ctg-0051 (Streptomyces albogriseolus); NPDC031026.ctg-0052 (Streptomyces albogriseolus); NPDC031026.ctg-0053 (Streptomyces albogriseolus); NPDC031026.ctg-0054 (Streptomyces albogriseolus); NPDC031026.ctg-0055 (Streptomyces albogriseolus); NPDC031026.ctg-0057 (Streptomyces albogriseolus); NPDC031026.ctg-0058 (Streptomyces albogriseolus); NPDC031026.ctg-0059 (Streptomyces albogriseolus); NPDC031026.ctg-0060 (Streptomyces albogriseolus); NPDC031026.ctg-0061 (Streptomyces albogriseolus); NPDC031026.ctg-0062 (Streptomyces albogriseolus); NPDC031026.ctg-0063 (Streptomyces albogriseolus); NPDC031026.ctg-0064 (Streptomyces albogriseolus); NPDC031026.ctg-0065 (Streptomyces albogriseolus); NPDC031026.ctg-0066 (Streptomyces albogriseolus); NPDC031026.ctg-0067 (Streptomyces albogriseolus); NPDC031026.ctg-0068 (Streptomyces albogriseolus); NPDC031026.ctg-0069 (Streptomyces albogriseolus); NPDC031026.ctg-0070 (Streptomyces albogriseolus); NPDC031026.ctg-0071 (Streptomyces albogriseolus); NPDC031026.ctg-0072 (Streptomyces albogriseolus); NPDC031026.ctg-0073 (Streptomyces albogriseolus); NPDC031026.ctg-0074 (Streptomyces albogriseolus); NPDC031026.ctg-0075 (Streptomyces albogriseolus); NPDC031026.ctg-0076 (Streptomyces albogriseolus); NPDC031026.ctg-0077 (Streptomyces albogriseolus)

Compact view

NPDC031026.ctg-0003 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 37,936 - 49,249 nt. (total: 11,314 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_01056: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.27	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.26	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.26	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001060.5	0.24	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.23	PKS	nenestatin	Micromonospora echinospora
BGC0001984.3	0.23	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000240.5	0.22	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000029.5	0.21	PKS	BE-14106	Streptomyces sp. DSM 21069

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.27	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.26	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.26	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001060.5	0.24	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.23	PKS	nenestatin	Micromonospora echinospora
BGC0001984.3	0.23	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000240.5	0.22	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000029.5	0.21	PKS	BE-14106	Streptomyces sp. DSM 21069

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NPDC031026.ctg-0003 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 72,309 - 94,465 nt. (total: 22,157 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase glucosidase peptidase

CDS_01101: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

CDS_01103: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

CDS_01107: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase

CDS_01099: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.87	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001285.5	0.40	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001792.5	0.32	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.87	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001285.5	0.40	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001792.5	0.32	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

CDS_01099: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 694): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.17 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.83 out of 23.43

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

NPDC031026.ctg-0003 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 227,258 - 258,432 nt. (total: 31,175 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_01259: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

CDS_01242: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

CDS_01264: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001374.5	0.44	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.66 out of 23.79

Confidence: medium

Additional weak hits (12):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.35 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.09 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.42 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.35 out of 29.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.23 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NPDC031026.ctg-0004 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 85,804 - 164,390 nt. (total: 78,587 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_01419: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_01420: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_01422: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CDS_01432: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase aminotransferase methyltransferase

CDS_01413: methyltransferase

smcogs: SMCOG1089: methyltransferase

CDS_01414: aminotransferase

smcogs: SMCOG1019: aminotransferase

CDS_01427: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase hydrolase

CDS_01421: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

CDS_01431: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CDS_01433: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

CDS_01429: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_01430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.46	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.41	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.41	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.41	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.40	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.40	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.40	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.39	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.94 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.18 out of 27.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.37 out of 29.51

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.61 out of 25.31

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.54 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.03 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.44 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 85803 - 164390:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Leu - D-Ala - Leu) + (D-Orn - Thr - D-X - Val - D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_01429: Orn - Thr - X - Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (506..890): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEDMGFVDK
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2009..2421): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3078..3471): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTENLGMVDK
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (76% 8Å match); Arg DTEDVGCVDK (74% 8Å match); Asp DMKDLGMVDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4584..4964): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWWGGTFK
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (97% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5615..5997): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALLIGSVVK
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (71% 8Å match); Leu DALLIGAVVK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

CDS_01430: Leu - Ala - Leu - Ala - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (40..418): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALLIGSIVK
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (68% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1077..1491): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAIVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2602..2997): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYFWGVTFK
Nearest Stachelhaus code(s):: Leu DAYFWGVTFK (97% 8Å match); Val DAYFWGVTFK (94% 8Å match); Ile DAYFWGVTFK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4118..4518): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAIVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5632..6017): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALLIGSVVK
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (74% 8Å match); Leu DALLIGAVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism

NPDC031026.ctg-0005 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 168,097 - 190,614 nt. (total: 22,518 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

CDS_01763: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.83	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001638.4	0.51	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002699.2	0.48	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002144.3	0.48	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002073.3	0.46	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.45	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001843.2	0.45	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000947.5	0.44	other (other)	vibrioferrin	Vibrio alginolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.83	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001638.4	0.51	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002699.2	0.48	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002144.3	0.48	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0002698.2	0.47	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002073.3	0.46	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.45	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001843.2	0.45	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000947.5	0.44	other (other)	vibrioferrin	Vibrio alginolyticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.23 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.65 out of 28.19

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.63 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.43 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.58 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.62 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.99 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.51 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.28 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.59 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.56 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.94 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.52 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NPDC031026.ctg-0007 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 111,379 - 131,900 nt. (total: 20,522 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

CDS_02310: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.49	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.32	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002667.2	0.30	ribosomal	estericin A	Clostridium estertheticum
BGC0000665.5	0.27	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000842.5	0.27	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000666.5	0.24	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001156.5	0.23	terpene	platencin	Streptomyces platensis
BGC0000722.5	0.23	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0000703.4	0.23	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000360.5	0.23	NRPS	GE81112	Streptomyces sp. L-49973

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.49	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.32	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002667.2	0.30	ribosomal	estericin A	Clostridium estertheticum
BGC0000665.5	0.27	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000842.5	0.27	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000666.5	0.24	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001156.5	0.23	terpene	platencin	Streptomyces platensis
BGC0000722.5	0.23	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0000703.4	0.23	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000360.5	0.23	NRPS	GE81112	Streptomyces sp. L-49973

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.47 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.34 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.02 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.00 out of 32.93

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.06 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 13 - 106; Score: 81.1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0008 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 185,154 - 214,926 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_02639: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_02644: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_02648: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: carboxylase transferase

CDS_02641: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CDS_02642: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

CDS_02647: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

CDS_02643: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.56	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.19 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (10):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.17 out of 29.51

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.86 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0013 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 47,670 nt. (total: 47,670 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CDS_03637: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CDS_03638: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

CDS_03648: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_03678: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: methyltransferase

CDS_03640: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CDS_03668: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

CDS_03641: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

CDS_03642: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

CDS_03644: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_03645: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

CDS_03656: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001366.5	0.57	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001386.5	0.55	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001366.5	0.57	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001386.5	0.55	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.50 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.22 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

Additional weak hits (15):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.56 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.54 out of 29.51

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.52 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.94 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.61 out of 23.43

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 47670
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

CDS_03640: MET C6|C8 (Score: 520.1; E-value: 4.5e-159)
CDS_03641: CYC C4-C21/C2-C23|C2-C19 (Score: 156.8; E-value: 3.4e-49)
CDS_03642: CYC C9-C14 (Score: 253.0; E-value: 1.8e-78)
CDS_03643: ACP (Score: 78.7; E-value: 5.8e-25)
CDS_03644: CLF (Score: 546.2; E-value: 1e-166)
CDS_03645: KS (Score: 717.7; E-value: 9.8e-219)
CDS_03646: CYC C5-C18 (Score: 213.0; E-value: 2.6e-66)
CDS_03648: OXY (Score: 278.9; E-value: 2e-85)
CDS_03675: MET (Score: 33.4; E-value: 5.8e-11)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0015 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 49,636 - 72,172 nt. (total: 22,537 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

CDS_04031: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

CDS_04013: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.49	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001696.5	0.45	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.45	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.42	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.41	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002120.3	0.41	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001474.4	0.36	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001762.3	0.34	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033
BGC0001473.4	0.34	ribosomal	Sch 18640	Micromonospora arborensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.49	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001696.5	0.45	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.45	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.42	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.41	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002120.3	0.41	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001474.4	0.36	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001762.3	0.34	other (other)	rubrolone A, rubrolone B	Streptomyces sp. KIB-H033
BGC0001473.4	0.34	ribosomal	Sch 18640	Micromonospora arborensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (2):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.61 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.96 out of 30.22

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0015 - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 77,061 - 97,780 nt. (total: 20,720 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: mutase

CDS_04054: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.69 out of 25.88

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.96 out of 32.93

Confidence: medium

Additional weak hits (9):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.05 out of 27.18

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.03 out of 31.73

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.76 out of 32.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.67 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.64 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
PsrA	Oleic acid responsive regulator
RicR	Copper-responsive regulator

NPDC031026.ctg-0016 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 54,059 - 76,552 nt. (total: 22,494 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CDS_04189: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.91	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.82	ribosomal	siamycin	Streptomyces nodosus
BGC0002074.2	0.71	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001549.3	0.67	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000579.4	0.63	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.91	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.82	ribosomal	siamycin	Streptomyces nodosus
BGC0002074.2	0.71	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001549.3	0.67	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000579.4	0.63	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (8):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.52 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 85; Score: 77.1; RRE type: Lasso_Fused_RRE; Location: 0 - 63; Score: 28.7

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0018 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 83,521 - 93,919 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

CDS_04509: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

CDS_04512: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CDS_04515: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NPDC031026.ctg-0023 - Region 1 - NRPS,NRPS-like,T1PKS,lanthipeptide-class-i,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 13,245 - 118,477 nt. (total: 105,233 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CDS_05095: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CDS_05111: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_05121: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

CDS_05122: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

CDS_05125: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_05143: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_05144: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_05146: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_05148: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acetyltransferase

CDS_05103: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CDS_05118: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

CDS_05126: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CDS_05149: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: cyclase

CDS_05107: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase synthase

CDS_05099: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CDS_05100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_05112: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_05113: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_05119: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.01	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.97	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.93	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.93	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.93	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.92	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.92	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.91	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.91	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.88	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (25):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.72 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.66 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.96 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.24 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.52 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.48 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.94 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.94 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.70 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.65 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.55 out of 32.93

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 13244 - 118477:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-ccmal - mal - Me-ohmal) + (X - Gln) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 24139 - 78140:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Gln) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 78064 - 118477:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-ccmal - mal - Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_05100: X

AMP-binding (8..417): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DARLASQMTK
Nearest Stachelhaus code(s):: Glu DPRSLSQMAK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_05112: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (537..964): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1620..2004): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALMQAVVWK
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (59% 8Å match); Leu DALVLAVSIK (56% 8Å match); aIle DALVFGVVLK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_05113: X - Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (525..914): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DADNVGAVTK
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1568..1959): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAEEVGTVSK
Nearest Stachelhaus code(s):: Lys DAEDNGTVSK (74% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

CDS_05119: X

AMP-binding (34..405): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -LLMWGGIVK
Nearest Stachelhaus code(s):: Gly DLLMWCAITK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

CDS_05149: AHBA - mmal - mal - mmal

CAL_domain (33..445): AHBA

minowa: AHBA

Prediction, score:

AHBA: 447.8
shikimic_acid: 242.1
Acetyl-CoA: 15.1
NH2: 8.2
fatty_acid: 0.0

PKS_AT (1647..1948): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.4
Ethylmalonyl-CoA: 207.5
Methoxymalonyl-CoA: 170.9
2-Methylbutyryl-CoA: 123.4
trans-1,2-CPDA: 116.2
Propionyl-CoA: 104.7
Malonyl-CoA: 91.4
CHC-CoA: 90.2
Isobutyryl-CoA: 75.4
Benzoyl-CoA: 60.9
fatty_acid: 46.2
Acetyl-CoA: 45.0
inactive: 14.2
3-Methylbutyryl-CoA: 12.0

PKS_AT (3356..3658): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.0
inactive: 97.4
Methoxymalonyl-CoA: 76.5
Methylmalonyl-CoA: 58.9
Isobutyryl-CoA: 38.6
Propionyl-CoA: 33.6
Benzoyl-CoA: 27.6
Ethylmalonyl-CoA: 24.4
CHC-CoA: 20.9
Acetyl-CoA: 19.0
trans-1,2-CPDA: 10.9
2-Methylbutyryl-CoA: 5.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4395..4696): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.7
Ethylmalonyl-CoA: 209.3
Methoxymalonyl-CoA: 170.8
2-Methylbutyryl-CoA: 128.5
trans-1,2-CPDA: 115.6
Propionyl-CoA: 104.6
Malonyl-CoA: 93.5
CHC-CoA: 87.0
Isobutyryl-CoA: 75.2
Benzoyl-CoA: 64.9
fatty_acid: 48.4
Acetyl-CoA: 45.7
3-Methylbutyryl-CoA: 16.7
inactive: 15.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0026 - Region 1 - T1PKS,T2PKS,butyrolactone

Download region GenBank file

Download region SVG

Location: 1 - 105,206 nt. (total: 105,206 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
T2PKS: (t2ks and t2clf)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CDS_05379: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_05382: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_05390: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_05402: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CDS_05403: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CDS_05410: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_05415: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_05416: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_05419: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CDS_05425: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

CDS_05433: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_05435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase aminotransferase glycosyltransferase halogenase transferase

CDS_05370: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_05371: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_05372: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_05374: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

CDS_05378: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CDS_05400: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CDS_05420: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

CDS_05430: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

CDS_05431: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CDS_05434: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase hydrolase

CDS_05380: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

CDS_05384: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_05406: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_05427: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase dehydratase

CDS_05417: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

CDS_05429: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

CDS_05375: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

CDS_05399: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_05407: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_05408: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_05414: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_05421: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.98	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.75	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001273.3	0.69	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.69	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.68	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000850.5	0.59	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001254.3	0.54	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000231.5	0.78	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002341.2	0.76	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000849.4	0.70	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000234.5	0.69	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Additional weak hits (21):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.32 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.15 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.56 out of 30.22

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.03 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.31 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.43 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.59 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.73 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.44 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 105206:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ccmal) + (Me-ccmal) + (ccmal - Me-ccmal)
Non-colinear ordering:: CDS_05370 + CDS_05371 + CDS_05372

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 49089:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ccmal) + (Me-ccmal) + (ccmal - Me-ccmal)
Non-colinear ordering:: CDS_05370 + CDS_05371 + CDS_05372

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_05370: mmal - mmal

PKS_AT (567..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.3
Ethylmalonyl-CoA: 200.0
Methoxymalonyl-CoA: 164.5
2-Methylbutyryl-CoA: 119.2
trans-1,2-CPDA: 109.8
Propionyl-CoA: 95.7
CHC-CoA: 93.6
Malonyl-CoA: 86.6
Isobutyryl-CoA: 78.2
Benzoyl-CoA: 55.1
Acetyl-CoA: 40.9
fatty_acid: 33.7
3-Methylbutyryl-CoA: 13.8
inactive: 13.7

PKS_AT (2318..2619): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.2
Ethylmalonyl-CoA: 208.5
Methoxymalonyl-CoA: 168.7
2-Methylbutyryl-CoA: 123.5
trans-1,2-CPDA: 117.2
Propionyl-CoA: 99.2
CHC-CoA: 92.8
Malonyl-CoA: 89.1
Isobutyryl-CoA: 83.1
Benzoyl-CoA: 64.3
Acetyl-CoA: 44.0
fatty_acid: 40.8
3-Methylbutyryl-CoA: 16.2
inactive: 14.8

CDS_05371: mmal

PKS_AT (613..914): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.1
Ethylmalonyl-CoA: 201.8
Methoxymalonyl-CoA: 165.8
2-Methylbutyryl-CoA: 119.8
trans-1,2-CPDA: 110.7
Propionyl-CoA: 96.1
CHC-CoA: 94.0
Malonyl-CoA: 88.9
Isobutyryl-CoA: 80.6
Benzoyl-CoA: 55.5
Acetyl-CoA: 41.2
fatty_acid: 33.1
inactive: 14.1
3-Methylbutyryl-CoA: 12.9

CDS_05372: mal - mmal

PKS_AT (597..900): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.2
inactive: 110.4
Methoxymalonyl-CoA: 81.3
Methylmalonyl-CoA: 68.2
Propionyl-CoA: 41.5
Ethylmalonyl-CoA: 32.7
Isobutyryl-CoA: 30.4
Acetyl-CoA: 27.2
fatty_acid: 22.9
Benzoyl-CoA: 22.0
2-Methylbutyryl-CoA: 21.8
trans-1,2-CPDA: 21.4
CHC-CoA: 20.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2362..2663): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.5
Ethylmalonyl-CoA: 203.2
Methoxymalonyl-CoA: 169.9
2-Methylbutyryl-CoA: 124.7
trans-1,2-CPDA: 113.9
Propionyl-CoA: 102.2
Malonyl-CoA: 91.9
CHC-CoA: 86.6
Isobutyryl-CoA: 79.1
Benzoyl-CoA: 69.0
fatty_acid: 51.7
Acetyl-CoA: 48.4
3-Methylbutyryl-CoA: 23.0
inactive: 17.7

CDS_05414: X

AMP-binding (16..424): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -YMYLGGPLK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 32812 to 105206
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 640.5; E-value: 2.1e-195)
Product molecular weight(s):: acetyl-CoA_8: 577 Da
acetyl-CoA_9: 619 Da

CDS_05382: OXY (Score: 213.5; E-value: 1.3e-65)
CDS_05390: OXY (Score: 342.2; E-value: 1.3e-104)
CDS_05407: KS (Score: 731.9; E-value: 4.5e-223)
CDS_05408: CLF 8|9 (Score: 640.5; E-value: 2.1e-195)
CDS_05409: ACP (Score: 110.1; E-value: 9.1e-35)
CDS_05410: OXY (Score: 174.6; E-value: 8.8e-54)
CDS_05411: CYC C5-C14 (Score: 470.2; E-value: 5.7e-144)
CDS_05413: CYC C1-C18|C2-C19 (Score: 173.2; E-value: 6e-54)
CDS_05415: OXY (Score: 398.7; E-value: 9.1e-122)
CDS_05416: KR C9 (Score: 455.6; E-value: 1.1e-139)
CDS_05417: CYC C7-C12 (Score: 437.6; E-value: 4.5e-134)
CDS_05434: GT (Score: 158.5; E-value: 7.4e-49)

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
OsdR	Development and stress management regulator

NPDC031026.ctg-0027 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 40,019 nt. (total: 40,019 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CDS_05439: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_05455: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase

CDS_05444: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase synthase

CDS_05440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_05456: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

CDS_05461: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.75	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.75	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 21.84 out of 21.84

Confidence: strong

Additional weak hits (7):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.27 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.07 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.07 out of 25.88

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.21 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 40019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - NMe-Hpg - Ala - Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_05440: Gly - Hpg - Ala - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (9..270): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (953..1345): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: DIYHLGLLCK
Nearest Stachelhaus code(s):: Hpg DIYHLGLLCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2417..2812): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVALVYK
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3470..3871): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NPDC031026.ctg-0034 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 19,141 nt. (total: 19,141 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_05982: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

CDS_05990: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: transferase

CDS_05991: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

CDS_05993: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

CDS_05981: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.52	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

CDS_05980: T2TS

Domain 1 (23 - 655): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

CDS_05981: PT_FPPS_like

Domain 1 (63 - 356): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CDS_05984: PT_phytoene_like

Domain 1 (17 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

CDS_05985: PT_phytoene_like

Domain 1 (27 - 292): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.62 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.74 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NPDC031026.ctg-0035 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 70,443 nt. (total: 70,443 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase phosphate reductase

CDS_06053: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_06066: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

CDS_06072: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

CDS_06083: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_06084: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase glycosyltransferase halogenase kinase methyltransferase

CDS_06059: halogenase

smcogs: SMCOG1119: halogenase

CDS_06068: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

CDS_06069: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CDS_06078: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CDS_06081: methyltransferase

smcogs: SMCOG1248: methyltransferase

CDS_06082: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CDS_06085: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

CDS_06055: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_06064: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_06065: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

CDS_06056: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_06057: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_06058: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_06061: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_06086: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001050.5	0.52	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001160.5	0.51	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.51	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.49	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002075.3	0.43	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001023.5	0.42	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca
BGC0000067.5	0.42	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001132.4	0.42	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.42	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001876.2	0.42	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.81 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (12):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.74 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.25 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.59 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.16 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.63 out of 23.43

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.67 out of 36.53

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 70443:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redemal) + (Me-ohmal) + (ohmal) + (D-X - Gly) + (D-Leu - Leu) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 43950:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Gly) + (D-Leu - Leu) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 31362 - 70443:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (redemal) + (ohmal)
Non-colinear ordering:: CDS_06085 + CDS_06086 + CDS_06084

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_06056: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (466..873): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

CDS_06057: Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (465..863): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAAYAK
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2008..2400): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVF-VAAYAK
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

CDS_06058: X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (465..862): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVASYAK
Nearest Stachelhaus code(s):: Piz DVFSVASYAK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2017..2394): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

CDS_06061: X

AMP-binding (19..424): X

nrpys: Leu, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLRHLGQDVK
Nearest Stachelhaus code(s):: Leu or Ser DLRHLGQDVK (97% 8Å match); Leu or Ala DLRHLGQDVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CDS_06084: mal

PKS_AT (605..900): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.4
inactive: 88.6
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 47.0
Propionyl-CoA: 41.2
Benzoyl-CoA: 19.9
Ethylmalonyl-CoA: 18.6
Isobutyryl-CoA: 17.2
Acetyl-CoA: 17.1
2-Methylbutyryl-CoA: 14.3
fatty_acid: 9.6
CHC-CoA: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CDS_06085: mmal

PKS_AT (550..840): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.6
Ethylmalonyl-CoA: 209.1
Methoxymalonyl-CoA: 174.6
2-Methylbutyryl-CoA: 158.1
trans-1,2-CPDA: 122.0
Propionyl-CoA: 112.5
CHC-CoA: 107.0
Malonyl-CoA: 90.9
Isobutyryl-CoA: 88.5
Benzoyl-CoA: 61.1
3-Methylbutyryl-CoA: 42.5
Acetyl-CoA: 41.0
fatty_acid: 40.5
inactive: 29.2

CDS_06086: emal

PKS_AT (1283..1580): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Methylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 240.5
Methylmalonyl-CoA: 203.1
Methoxymalonyl-CoA: 180.4
trans-1,2-CPDA: 156.6
2-Methylbutyryl-CoA: 143.5
Propionyl-CoA: 112.3
CHC-CoA: 95.3
Malonyl-CoA: 82.9
Isobutyryl-CoA: 77.5
Benzoyl-CoA: 60.2
Acetyl-CoA: 52.8
3-Methylbutyryl-CoA: 41.2
fatty_acid: 40.0
inactive: 23.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NPDC031026.ctg-0036 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 50,077 nt. (total: 50,077 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CDS_06093: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CDS_06094: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CDS_06105: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CDS_06115: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CDS_06119: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase aminotransferase

CDS_06107: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

CDS_06118: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

CDS_06120: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Ligases: ligase synthase

CDS_06102: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CDS_06103: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_06104: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CDS_06108: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	1.20	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	1.10	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	1.02	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	0.84	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	0.82	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.79	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.76 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.42 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.54 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.33 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.31 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.82 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.32 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 50077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_06103: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (460..872): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1704..2113): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 15.5
AHBA: 4.0
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: -3.1

CDS_06104: mal

PKS_AT (563..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 105.4
Methoxymalonyl-CoA: 65.2
inactive: 55.9
Methylmalonyl-CoA: 43.0
Ethylmalonyl-CoA: 25.8
Propionyl-CoA: 18.8
Isobutyryl-CoA: 18.3
Benzoyl-CoA: 11.7
fatty_acid: 8.8
2-Methylbutyryl-CoA: 5.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CDS_06108: X

AMP-binding (7..402): X

nrpys: Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVWLGVGFK
Nearest Stachelhaus code(s):: Ant GSVWLGVGFK (100% 8Å match); Pyv or Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence

NPDC031026.ctg-0037 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 46,230 nt. (total: 46,230 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CDS_06142: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CDS_06144: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CDS_06152: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

CDS_06146: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_06147: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CDS_06149: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

CDS_06145: thioesterase

smcogs: SMCOG1004: thioesterase

CDS_06156: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

CDS_06148: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CDS_06150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CDS_06151: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transport

CDS_06157: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.93	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.93	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.92	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.81	PKS	oronofacic acid	Pseudomonas syringae
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001050.5	0.68	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.25 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.70 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.01 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.64 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 46230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (pk) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 42927:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (pk) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 3131 - 46230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (pk) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_06146: mmal

PKS_AT (610..905): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 176.6
Ethylmalonyl-CoA: 173.4
Methoxymalonyl-CoA: 150.6
2-Methylbutyryl-CoA: 113.3
Malonyl-CoA: 98.9
CHC-CoA: 96.1
trans-1,2-CPDA: 88.6
Propionyl-CoA: 88.6
Isobutyryl-CoA: 45.3
inactive: 41.3
Benzoyl-CoA: 39.3
Acetyl-CoA: 33.8
3-Methylbutyryl-CoA: 31.1
fatty_acid: 29.2

CDS_06147: pk

PKS_AT (578..877): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%; Methylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 165.0
Ethylmalonyl-CoA: 164.1
Methoxymalonyl-CoA: 138.5
2-Methylbutyryl-CoA: 108.7
Propionyl-CoA: 99.6
Malonyl-CoA: 97.2
trans-1,2-CPDA: 94.8
CHC-CoA: 82.7
Isobutyryl-CoA: 60.0
inactive: 53.2
Benzoyl-CoA: 45.8
Acetyl-CoA: 36.0
fatty_acid: 17.8
3-Methylbutyryl-CoA: 14.5

CDS_06148: mal

PKS_AT (575..871): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 162.5
Methylmalonyl-CoA: 84.5
Methoxymalonyl-CoA: 68.8
Ethylmalonyl-CoA: 55.0
inactive: 50.9
Propionyl-CoA: 49.2
CHC-CoA: 35.2
Isobutyryl-CoA: 33.9
fatty_acid: 29.3
Benzoyl-CoA: 28.6
trans-1,2-CPDA: 28.0
2-Methylbutyryl-CoA: 26.0
Acetyl-CoA: 24.2
3-Methylbutyryl-CoA: 0.0

CDS_06149: mmal

PKS_AT (589..885): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.8
Ethylmalonyl-CoA: 216.5
Methoxymalonyl-CoA: 178.4
2-Methylbutyryl-CoA: 162.4
trans-1,2-CPDA: 133.5
Propionyl-CoA: 122.0
Malonyl-CoA: 114.6
CHC-CoA: 105.9
Isobutyryl-CoA: 97.6
Benzoyl-CoA: 75.1
Acetyl-CoA: 45.9
3-Methylbutyryl-CoA: 44.6
inactive: 35.7
fatty_acid: 34.8

CDS_06150: X

AMP-binding (462..830): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALWWGGLLK
Nearest Stachelhaus code(s):: 3OH-Leu DALWWGGVLK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NPDC031026.ctg-0039 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,479 - 22,600 nt. (total: 21,122 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

CDS_06229: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

CDS_06238: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CDS_06238: PT_FPPS_like

Domain 1 (86 - 371): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NPDC031026.ctg-0039 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 24,928 - 45,941 nt. (total: 21,014 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CDS_06259: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

CDS_06261: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

CDS_06260: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002181.3	0.37	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002181.3	0.37	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CDS_06260: T1TS

Domain 1 (5 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.17 out of 27.04

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.31 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (2):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
NrdR	Represses ribonucleotide reductase encoding genes

NPDC031026.ctg-0044 - Region 1 - NRPS,lassopeptide

Download region GenBank file

Download region SVG

Location: 7,649 - 38,979 nt. (total: 31,331 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

CDS_06466: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: ligase

CDS_06485: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.82	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.81	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.75	ribosomal	anantin C	Streptomyces olindensis
BGC0001779.5	0.72	ribosomal	siamycin	Streptomyces nodosus
BGC0001493.5	0.71	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001889.2	0.67	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001549.3	0.57	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.57	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000579.4	0.57	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0002064.2	0.54	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001779.5	0.71	ribosomal	siamycin	Streptomyces nodosus
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.68	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001889.2	0.67	ribosomal	fusilassin	Thermobifida fusca YX
BGC0000579.4	0.63	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001549.3	0.62	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.62	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0002318.2	0.61	ribosomal	canucin A, canucin B	Streptomyces canus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 84; Score: 86.2; RRE type: Lasso_Fused_RRE; Location: 0 - 83; Score: 33.2

TFBS definitions

Regulator	Description

NPDC031026.ctg-0046 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 22,185 nt. (total: 22,185 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

CDS_06520: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

CDS_06522: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.46	ribosomal	subtilomycin	Bacillus subtilis
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000565.5	0.43	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000556.5	0.42	ribosomal	streptin	Streptococcus pyogenes
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.70	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.47	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.46	ribosomal	subtilomycin	Bacillus subtilis
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000565.5	0.43	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000556.5	0.42	ribosomal	streptin	Streptococcus pyogenes
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CDS_06522

CDS_06523

Leader:

MLNTLSLFQQPAEPDDEGFPVDWELTTTVTASPV

Core:

PIVEACGSGDGCKSTCASSCISS

Core with dehydrations:

PIVEACysGDhaGDGCysKDhaDhbCysADhaDhaCysIDhaDha

antiSMASH-DB 4.0 matches for CDS_06523

69.6%

NC_017765.1:

Lanthipeptides: SHJG_RS39685_lanthipeptide

5

ACGSGDGCKSTCASSCISS

23

ACG+GDGCKSTCASSC S+

1

ACGTGDGCKSTCASSCTSA

19

69.6%

NZ_AQRK01000063.1:

Lanthipeptides: YUW_RS35350_lanthipeptide

1

PIVEACGSGDGCKSTCASSCIS

22

PIV +C +GDGC STCASSC S

1

PIVSSCDTGDGCASTCASSCAS

22

69.6%

NZ_CP023202.1and 1 other:

NZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10575_lanthipeptide

Lanthipeptides: SXIN_RS22820_lanthipeptide

5

ACGSGDGCKSTCASSCISS

23

ACG+GDGCKSTCASSC S+

1

ACGTGDGCKSTCASSCASA

19

with 173 more sequence matches

Only the first 10 are displayed here.

65.2%

NZ_BMSX01000004.1:

Lanthipeptides: IE263_RS11225_lanthipeptide

5

ACGSGDGCKSTCASSCISS

23

ACG+GDGC STCASSC S+

1

ACGTGDGCASTCASSCASA

19

56.5%

NZ_CP012752.1:

Lanthipeptides: AOZ06_RS53910_lanthipeptide

2

IVEACGSGDGCKSTCASSCISS

23

+ AC + DGC TCASSCIS+

1

VASACDTSDGCDPTCASSCIST

22

56.5%

NZ_CP095474.1:

Lanthipeptides: MW084_RS03280_lanthipeptide

5

ACGSGDGCKSTCASSCISS

23

ACG+GDGC +TC+SSC S+

1

ACGTGDGCGATCSSSCTSA

19

56.5%

NZ_JAMTCO010000027.1and 1 other:

NZ_RCDD01000001.1 Lanthipeptides: CLV68_RS12320_lanthipeptide

Lanthipeptides: LV75_RS34630_lanthipeptide

5

ACGSGDGCKSTCASSCISS

23

AC + DGC STCASSC+S+

1

ACATDDGCASTCASSCVSN

19

56.5%

NZ_QQAU01000011.1:

Lanthipeptides: DFR72_RS30360_lanthipeptide

2

IVEACGSGDGCKSTCASSCISS

23

+ AC + DGC TCASSCIS+

1

VASACDTSDGCDPTCASSCISA

22

52.2%

NZ_CP034550.1:

Lanthipeptides: EKG83_RS09715_lanthipeptide

2

IVEACGSGDGCKSTCASSCISS

23

I + C + DGC TCASSC+S+

1

ISDGCATDDGCDPTCASSCVSN

22

51.9%

NZ_FMZZ01000004.1:

Lanthipeptides: BLS56_RS10220_lanthipeptide

3

VEACGSG--DGCKSTCASSCIS

22

+ ACG+G DGC TCAS+CIS

3

LSACGNGTDDGCDPTCASACIS

24

47.8%

NZ_CM001489.1and 1 other:

NZ_CM001489.1 Lanthipeptides: FRAQA3DRAFT_RS33245_lanthipeptide

Lanthipeptides: FRAQA3DRAFT_RS33245_lanthipeptide

6

CGSGDGCKSTCASSCISS

23

C + DGC STC S+C SS

2

CDTSDGCSSTCPSACASS

19

47.8%

NZ_FAOZ01000022.1:

Lanthipeptides: AWX74_RS26225_lanthipeptide

5

ACGSGDGCKSTCASSCIS

22

AC + D C STCAS+C S

1

ACDTSDTCGSTCASACAS

18

47.8%

NZ_JADMLH010000005.1:

Lanthipeptides: IT780_RS15200_lanthipeptide

4

EACGSGDGCKSTCASSCIS

22

C + DGC STCAS+C S

1

RGCDTNDGCGSTCASACAS

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.75 out of 29.65

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.24 out of 23.43

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.32 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

CDS_06523 - Class I

Cleavage pHMM score: -12.20

RODEO score: 19

Monoisotopic mass: 2034.9 Da

Molecular weight: 2036.3 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2054.3 Da N = 1; 2072.3 Da N = 2; 2090.3 Da N = 3

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
LexA variant 1	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NPDC031026.ctg-0056 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 13,786 nt. (total: 13,786 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

CDS_06715: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

CDS_06714: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 13786:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (ccmal)
Non-colinear ordering:: CDS_06715 + CDS_06714

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

CDS_06714: mal

PKS_AT (594..907): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.0
inactive: 77.8
Methoxymalonyl-CoA: 68.3
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 27.0
Isobutyryl-CoA: 24.9
Acetyl-CoA: 19.1
2-Methylbutyryl-CoA: 16.3
CHC-CoA: 14.4
Benzoyl-CoA: 12.8
Ethylmalonyl-CoA: 12.7
fatty_acid: 10.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CDS_06715: mmal

PKS_AT (1276..1566): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 225.9
Ethylmalonyl-CoA: 217.5
Methoxymalonyl-CoA: 184.0
2-Methylbutyryl-CoA: 169.7
trans-1,2-CPDA: 127.8
Propionyl-CoA: 120.7
CHC-CoA: 111.7
Malonyl-CoA: 100.8
Isobutyryl-CoA: 88.2
Benzoyl-CoA: 62.8
fatty_acid: 50.5
3-Methylbutyryl-CoA: 49.3
Acetyl-CoA: 41.3
inactive: 27.7

Link to PARAS substrate predictor