Streptomyces_milbemycinicus_NRRL_5739 - 117 region(s)

Download region SVG

Location: 1 - 6,181 nt. (total: 6,181 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg5_5: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

ctg5_8: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.79	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.79	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.79	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.79	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

MUNE01000102.1 - Region 1 - NRPS,PKS-like

Download region SVG

Location: 1 - 40,843 nt. (total: 40,843 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg18_5: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg18_6: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg18_7: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase synthase

ctg18_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg18_12: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg18_14: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg18_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg18_3: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.78	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.27 out of 31.73

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 40843:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (X - Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 31103:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (X - Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg18_1: X

AMP-binding (31..336): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMVTIGALAK
Nearest Stachelhaus code(s):: Tyr DMVICGCAAK (41% 8Å match); Arg DVESIGAIAK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

ctg18_2: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (487..888): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWLVGAVIK
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg18_3: X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (477..880): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASDAGLVDK
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (65% 8Å match); Lys DADDAGTVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1548..1955): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWLVGAVMK
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg18_14: X

AMP-binding (8..398): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLLQVANNSK
Nearest Stachelhaus code(s):: Ala DLLVVAGILK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description

MUNE01001027.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 3,115 nt. (total: 3,115 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg23_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001251.4	0.63	NRPS	epichloenin A	Epichloe festucae
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg23_1: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (675..1038): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVAAVYK
Nearest Stachelhaus code(s):: Ala DVFSVAAVYK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01001053.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 1,588 nt. (total: 1,588 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.42	PKS	BAB, BAA	Metarhizium anisopliae
BGC0001400.3	0.41	PKS	citreoviridin	Aspergillus terreus NIH2624
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000979.3	0.36	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002240.3	0.42	PKS	BAB, BAA	Metarhizium anisopliae
BGC0001400.3	0.41	PKS	citreoviridin	Aspergillus terreus NIH2624
BGC0002749.2	0.38	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000979.3	0.36	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg47_2: mal

PKS_AT (193..300): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 23.9
Methylmalonyl-CoA: 18.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MUNE01000011.1 - Region 1 - terpene

Download region SVG

Location: 1 - 11,310 nt. (total: 11,310 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg72_6: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthase

ctg72_5: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.62	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000860.3	0.42	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.62	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0000666.5	0.42	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000860.3	0.42	other (other)	ectoine	Methylarcula marina

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

ctg72_1: T2TS

Domain 1 (11 - 426): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.66 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

MUNE01000110.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 28,937 nt. (total: 28,937 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

ctg73_2: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

ctg73_5: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Ligases: ligase

ctg73_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

ctg73_9: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.61 out of 36.53

Confidence: medium

Additional weak hits (1):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28937:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Val - Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg73_1: Val - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (489..886): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYWWGGTFK
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2189..2591): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

MUNE01000111.1 - Region 1 - RiPP-like

Download region SVG

Location: 1 - 5,217 nt. (total: 5,217 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

ctg81_2: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Ligases: ligase

ctg81_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.44	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000477.3	0.38	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000483.5	0.37	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000528.5	0.37	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000565.5	0.36	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000122.5	0.35	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000193.3	0.35	PKS	aclacinomycin	Streptomyces galilaeus
BGC0002485.2	0.35	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.44	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000477.3	0.38	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000483.5	0.37	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000528.5	0.37	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000565.5	0.36	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000122.5	0.35	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000193.3	0.35	PKS	aclacinomycin	Streptomyces galilaeus
BGC0002485.2	0.35	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.77 out of 27.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

MUNE01000116.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 50,308 nt. (total: 50,308 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg112_18: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

ctg112_17: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: deaminase

ctg112_32: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

ctg112_19: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg112_20: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg112_23: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg112_24: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg112_25: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: transport

ctg112_31: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 27.04

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.67 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.52 out of 30.98

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 50308:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - D-X) + (X - Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg112_23: X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (478..879): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIWEVTADDK
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1532..1934): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg112_24: X - X

AMP-binding (468..873): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIWEVTADDK
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1529..1927): X

nrpys: Leu, Met

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWCIAAVCK
Nearest Stachelhaus code(s):: Leu or Met DAWCIAAVCK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

MUNE01000118.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 43,332 nt. (total: 43,332 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg124_19: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg124_20: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase

ctg124_21: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: hydratase

ctg124_7: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (12):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.82 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.35 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.72 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.34 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.97 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.43 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 26.85

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 43332:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal) + (Me-redmal) + (ccmal - Me-redmal)
Non-colinear ordering:: ctg124_18 + ctg124_19 + ctg124_20

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg124_18: mal - mmal

PKS_AT (567..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.9
inactive: 105.8
Methoxymalonyl-CoA: 68.3
Methylmalonyl-CoA: 56.4
Isobutyryl-CoA: 31.5
Propionyl-CoA: 29.8
Acetyl-CoA: 24.6
Ethylmalonyl-CoA: 20.0
Benzoyl-CoA: 18.6
fatty_acid: 16.7
CHC-CoA: 13.2
3-Methylbutyryl-CoA: 8.2
2-Methylbutyryl-CoA: 4.5
trans-1,2-CPDA: 0.0

PKS_AT (1594..1894): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 203.5
Ethylmalonyl-CoA: 191.4
Methoxymalonyl-CoA: 159.9
2-Methylbutyryl-CoA: 147.2
trans-1,2-CPDA: 134.8
Propionyl-CoA: 114.3
CHC-CoA: 94.6
Malonyl-CoA: 93.8
Isobutyryl-CoA: 69.4
Benzoyl-CoA: 62.1
Acetyl-CoA: 47.4
fatty_acid: 43.9
3-Methylbutyryl-CoA: 32.3
inactive: 26.5

ctg124_19: mmal

PKS_AT (577..874): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 217.9
Ethylmalonyl-CoA: 213.8
Methoxymalonyl-CoA: 173.1
2-Methylbutyryl-CoA: 145.1
trans-1,2-CPDA: 130.4
Propionyl-CoA: 127.5
Malonyl-CoA: 108.6
CHC-CoA: 92.6
Isobutyryl-CoA: 66.3
Acetyl-CoA: 55.4
Benzoyl-CoA: 50.4
fatty_acid: 50.3
inactive: 32.8
3-Methylbutyryl-CoA: 30.2

ctg124_20: mal - mmal

PKS_AT (577..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.5
inactive: 109.7
Methoxymalonyl-CoA: 63.1
Methylmalonyl-CoA: 58.9
Ethylmalonyl-CoA: 32.6
Propionyl-CoA: 29.6
Isobutyryl-CoA: 27.4
Benzoyl-CoA: 21.7
Acetyl-CoA: 20.4
CHC-CoA: 17.5
2-Methylbutyryl-CoA: 12.2
trans-1,2-CPDA: 9.3
fatty_acid: 8.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2412..2712): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.0
Ethylmalonyl-CoA: 196.6
Methoxymalonyl-CoA: 164.7
2-Methylbutyryl-CoA: 154.3
trans-1,2-CPDA: 130.6
Propionyl-CoA: 116.1
CHC-CoA: 103.0
Malonyl-CoA: 90.1
Isobutyryl-CoA: 75.2
Benzoyl-CoA: 56.2
Acetyl-CoA: 43.0
3-Methylbutyryl-CoA: 38.0
inactive: 29.3
fatty_acid: 27.0

ctg124_21: mmal

PKS_AT (584..826): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 168.6
Ethylmalonyl-CoA: 160.4
Methoxymalonyl-CoA: 134.6
2-Methylbutyryl-CoA: 116.3
trans-1,2-CPDA: 107.7
Propionyl-CoA: 83.9
Malonyl-CoA: 73.6
CHC-CoA: 69.6
Isobutyryl-CoA: 45.7
Benzoyl-CoA: 45.1
fatty_acid: 30.7
Acetyl-CoA: 20.6
inactive: 19.3
3-Methylbutyryl-CoA: 7.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
MexT	Global virulence regulator

MUNE01000128.1 - Region 1 - NRPS,NRPS-like

Download region SVG

Location: 1 - 20,341 nt. (total: 20,341 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase aminotransferase

ctg164_1: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

ctg164_13: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

ctg164_12: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: lyase

ctg164_9: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

ctg164_10: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg164_15: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg164_8: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.39 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.66 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 20341:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Pro) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg164_10: X

AMP-binding (16..411): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFIQGLTGK
Nearest Stachelhaus code(s):: Leu DAFLHGLTAK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

ctg164_13: mal

PKS_AT (26..315): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 83.2
inactive: 40.5
Methoxymalonyl-CoA: 33.1
Methylmalonyl-CoA: 25.6
fatty_acid: 22.7
Isobutyryl-CoA: 15.6
Propionyl-CoA: 11.9
Benzoyl-CoA: 10.2
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg164_15: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (1350..1753): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DAHIATNVVK
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description

MUNE01000132.1 - Region 1 - NI-siderophore,NRPS

Download region SVG

Location: 1 - 11,618 nt. (total: 11,618 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

ctg174_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg174_5: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg174_6: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001050.5	0.64	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001050.5	0.66	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.89 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.41 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 11618:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg174_4: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLCDK
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg174_6: X

AMP-binding (536..831): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIVQMGM--K
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

MUNE01000142.1 - Region 1 - lassopeptide

Download region SVG

Location: 1 - 16,341 nt. (total: 16,341 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg186_2: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

ctg186_5: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.74	ribosomal	ulleungdin	Streptomyces sp.
BGC0001548.4	0.66	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.66	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001781.4	0.65	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001552.3	0.63	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001506.5	0.62	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.61	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.61	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001493.5	0.61	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.74	ribosomal	ulleungdin	Streptomyces sp.
BGC0001548.4	0.66	ribosomal	citrulassin A	Streptomyces albulus
BGC0001307.3	0.66	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001781.4	0.65	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001552.3	0.63	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001506.5	0.62	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.61	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.61	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001493.5	0.61	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for allorf_02108_02257

allorf_02108_02257

Leader:

MNPVEEAEETTEVYEPPMVTEAGDFSEVTA

Full core:

GSIFGFQYDGGFYPYSQYG

Putative macrolactam:

GSIFGFQYD

antiSMASH-DB 4.0 matches for allorf_02108_02257

100.0%

NC_016582.1:

Lassopeptides: SBI_RS53910_lassopeptide

1

GSIFGFQYDGGFYPYSQYG

19

GSIFGFQYDGGFYPYSQYG

1

GSIFGFQYDGGFYPYSQYG

19

45.5%

NZ_BNBL01000011.1:

Lassopeptides: IE295_RS25550_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G QY+GGF PY Y

1

GEATGAQYEGGFPPYEWY

18

40.9%

NZ_BMNG01000001.1and 1 other:

NZ_CP048641.1 Lassopeptides: G3H79_RS13380_lassopeptide

Lassopeptides: IEY91_RS02775_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G +Y+GGF PY Y

1

GEALGARYEGGFPPYEWY

18

with 10 more sequence matches

40.9%

NZ_BMSK01000006.1:

Lassopeptides: IE251_RS14140_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G FG++ DGG PY Y

1

GWPFGYRRDGGLPPYWLY

18

40.9%

NZ_BMUM01000011.1and 2 others:

NZ_CP022685.1 Lassopeptides: KY5_RS41585_lassopeptideNZ_CP066831.1 Lassopeptides: JEQ17_RS43720_lassopeptide

Lassopeptides: IE284_RS31510_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G Y+GGF PY Y

1

GEALGAFYEGGFPPYEWY

18

40.9%

NZ_CP023699.1:

Lassopeptides: CP970_RS03810_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G Y+GGF PY Y

1

GEPLGAFYEGGFPPYEWY

18

40.9%

NZ_CP040916.1:

Lassopeptides: FH965_RS40555_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G Y+GGF PY Y

1

GEALGSYYEGGFPPYEWY

18

40.9%

NZ_CP050504.1:

Lassopeptides: HB370_RS02875_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G FG + DGG PY Y

1

GWPFGHRRDGGLPPYWLY

18

40.9%

NZ_JANFDE010000002.1and 1 other:

NZ_WPBY01000032.1 Lassopeptides: GO001_RS30935_lassopeptide

Lassopeptides: FHS35_RS09150_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G G Y+GGF PY Y

1

GEALGAHYEGGFPPYEWY

18

36.4%

NZ_AP024135.1and 1 other:

NZ_CP011799.1 Lassopeptides: QR97_RS38205_lassopeptide

Lassopeptides: K6K39_RS01405_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G +G +YDGG PY ++

1

GWPWGDRYDGGLPPYWRF

18

36.4%

NZ_BNCB01000003.1:

Lassopeptides: IE323_RS06225_lassopeptide

1

GSIFGFQYDGGFYPYSQY

18

G +G +YDGG PY ++

1

GWPWGNRYDGGLPPYWRF

18

24.0%

NZ_LR134406.1:

Lanthipeptides: EL272_RS00695_lanthipeptide

1

GSIFGFQYDGGFYPYSQ

17

GSIF F ++ +Q

3

GSIFSFTHECNTNTMTQ

19

12.8%

NZ_CP024200.1:

Lanthipeptides: allorf_478534_478758_lanthipeptide

7

QYDGGFYPYSQ

17

+Y GGF P+ +

6

EYPGGFAPWCR

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.53 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.69 out of 30.11

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.96 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.89 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.81 out of 20.01

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 26.85

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 27.04

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

allorf_02108_02257 - Class II: Cleavage pHMM score: 4.80; RODEO score: 19; Monoisotopic mass: 2133.9 Da; Molecular weight: 2135.2 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 67; Score: 62.8; RRE type: Lasso_Fused_RRE; Location: 1 - 53; Score: 25.4; RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 84; Score: 82.2; RRE type: Lasso_Fused_RRE; Location: 0 - 65; Score: 26.7

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

MUNE01000143.1 - Region 1 - terpene

Download region SVG

Location: 1 - 14,617 nt. (total: 14,617 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg187_9: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase

ctg187_3: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.56	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001521.3	0.33	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002571.2	0.32	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000606.5	0.30	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001760.5	0.30	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0002657.2	0.29	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0002666.2	0.27	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0002805.2	0.27	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.56	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001521.3	0.33	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002571.2	0.32	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000606.5	0.30	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001760.5	0.30	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0002657.2	0.29	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0002666.2	0.27	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0002805.2	0.27	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

ctg187_3: T1TS + T1TS

Domain 1 (2 - 330): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (332 - 709): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

MUNE01000148.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 43,716 nt. (total: 43,716 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg192_13: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg192_7: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: acylase

ctg192_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg192_4: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

ctg192_16: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

ctg192_6: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

ctg192_3: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000018.5	0.66	PKS	angolamycin	Streptomyces eurythermus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000018.5	0.66	PKS	angolamycin	Streptomyces eurythermus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

Additional weak hits (13):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.48 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.93 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.53 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.34 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.98 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.44 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.40 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.58 out of 27.04

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 43716:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (ccemal) + (Me-ccmal) + (pk)
Non-colinear ordering:: ctg192_2 + ctg192_3 + ctg192_4 + ctg192_5

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg192_2: mmal

PKS_AT (590..888): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.4
Ethylmalonyl-CoA: 197.9
Methoxymalonyl-CoA: 165.3
2-Methylbutyryl-CoA: 147.4
Propionyl-CoA: 121.5
trans-1,2-CPDA: 115.9
Malonyl-CoA: 99.3
CHC-CoA: 85.4
Isobutyryl-CoA: 70.6
Benzoyl-CoA: 68.4
Acetyl-CoA: 49.9
3-Methylbutyryl-CoA: 45.8
fatty_acid: 42.1
inactive: 26.6

ctg192_3: emal

PKS_AT (578..876): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 79.2%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 182.6
Methylmalonyl-CoA: 181.5
Methoxymalonyl-CoA: 146.7
2-Methylbutyryl-CoA: 122.6
Propionyl-CoA: 103.5
trans-1,2-CPDA: 99.3
CHC-CoA: 86.9
Malonyl-CoA: 79.3
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 58.7
Acetyl-CoA: 54.4
fatty_acid: 48.1
3-Methylbutyryl-CoA: 39.4
inactive: 16.0

ctg192_4: mmal

PKS_AT (585..883): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.0
Ethylmalonyl-CoA: 198.5
Methoxymalonyl-CoA: 172.6
2-Methylbutyryl-CoA: 153.7
trans-1,2-CPDA: 124.8
Propionyl-CoA: 120.9
Malonyl-CoA: 98.0
CHC-CoA: 94.2
Isobutyryl-CoA: 77.8
Benzoyl-CoA: 63.7
Acetyl-CoA: 56.2
3-Methylbutyryl-CoA: 52.3
fatty_acid: 39.2
inactive: 30.5

ctg192_5: pk

PKS_AT (573..870): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 197.5
Methylmalonyl-CoA: 196.6
Methoxymalonyl-CoA: 171.7
2-Methylbutyryl-CoA: 140.6
trans-1,2-CPDA: 137.0
Propionyl-CoA: 106.9
CHC-CoA: 105.9
Malonyl-CoA: 83.8
Isobutyryl-CoA: 67.7
Benzoyl-CoA: 37.9
Acetyl-CoA: 31.1
fatty_acid: 29.0
3-Methylbutyryl-CoA: 28.9
inactive: 25.2

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

MUNE01000149.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 27,713 nt. (total: 27,713 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg193_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

ctg193_1: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000143.5	0.62	PKS	salinomycin	Streptomyces albus
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000143.5	0.62	PKS	salinomycin	Streptomyces albus
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 27713:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal - Me-ohmal - ohmal - Me-ohmal) + (ccmal)
Non-colinear ordering:: ctg193_1 + ctg193_2

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg193_1: mmal - mmal - mal - mmal

PKS_AT (250..548): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.9
Ethylmalonyl-CoA: 217.5
Methoxymalonyl-CoA: 182.3
2-Methylbutyryl-CoA: 143.4
trans-1,2-CPDA: 134.6
Propionyl-CoA: 112.0
CHC-CoA: 102.0
Malonyl-CoA: 80.3
Isobutyryl-CoA: 68.8
Benzoyl-CoA: 55.4
Acetyl-CoA: 44.9
fatty_acid: 39.0
3-Methylbutyryl-CoA: 30.6
inactive: 20.5

PKS_AT (2309..2607): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 222.3
Ethylmalonyl-CoA: 215.6
Methoxymalonyl-CoA: 183.4
2-Methylbutyryl-CoA: 143.1
trans-1,2-CPDA: 132.2
Propionyl-CoA: 116.9
CHC-CoA: 98.8
Malonyl-CoA: 84.6
Isobutyryl-CoA: 67.4
Benzoyl-CoA: 55.2
fatty_acid: 39.7
Acetyl-CoA: 39.6
3-Methylbutyryl-CoA: 32.5
inactive: 24.5

PKS_AT (3854..4152): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.0
inactive: 93.7
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 24.5
Ethylmalonyl-CoA: 20.0
fatty_acid: 17.1
Isobutyryl-CoA: 17.0
Acetyl-CoA: 16.3
Benzoyl-CoA: 14.5
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (5393..5691): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 221.8
Ethylmalonyl-CoA: 211.2
Methoxymalonyl-CoA: 180.5
2-Methylbutyryl-CoA: 136.2
trans-1,2-CPDA: 131.5
Propionyl-CoA: 111.7
CHC-CoA: 96.1
Malonyl-CoA: 80.4
Isobutyryl-CoA: 66.6
Benzoyl-CoA: 55.3
Acetyl-CoA: 38.5
fatty_acid: 37.6
3-Methylbutyryl-CoA: 28.3
inactive: 22.0

ctg193_2: mal - mal

PKS_AT (583..873): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 217.3
inactive: 106.2
Methoxymalonyl-CoA: 57.4
Methylmalonyl-CoA: 38.8
Propionyl-CoA: 29.2
Acetyl-CoA: 21.9
2-Methylbutyryl-CoA: 17.9
Ethylmalonyl-CoA: 17.6
Isobutyryl-CoA: 14.3
Benzoyl-CoA: 11.5
fatty_acid: 11.3
CHC-CoA: 10.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2375..2665): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.6
inactive: 78.3
Methoxymalonyl-CoA: 67.5
Methylmalonyl-CoA: 57.5
Propionyl-CoA: 31.0
Isobutyryl-CoA: 28.1
2-Methylbutyryl-CoA: 25.9
Ethylmalonyl-CoA: 18.5
Benzoyl-CoA: 17.0
Acetyl-CoA: 14.3
CHC-CoA: 8.7
fatty_acid: 8.6
trans-1,2-CPDA: 7.7
3-Methylbutyryl-CoA: 0.0

MUNE01000150.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 17,912 nt. (total: 17,912 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg195_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg195_1: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 17912:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal - ohemal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg195_1: mmal - emal

PKS_AT (1600..1898): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.0
Ethylmalonyl-CoA: 206.9
Methoxymalonyl-CoA: 180.8
2-Methylbutyryl-CoA: 145.6
trans-1,2-CPDA: 128.8
Propionyl-CoA: 117.2
CHC-CoA: 102.3
Malonyl-CoA: 96.4
Isobutyryl-CoA: 87.0
Benzoyl-CoA: 61.5
Acetyl-CoA: 49.4
fatty_acid: 43.4
3-Methylbutyryl-CoA: 43.2
inactive: 30.6

PKS_AT (3679..3977): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 198.0
Methylmalonyl-CoA: 193.4
Methoxymalonyl-CoA: 157.6
2-Methylbutyryl-CoA: 124.8
Propionyl-CoA: 110.1
trans-1,2-CPDA: 109.0
Isobutyryl-CoA: 94.9
Malonyl-CoA: 87.5
CHC-CoA: 81.9
Benzoyl-CoA: 64.4
Acetyl-CoA: 54.4
3-Methylbutyryl-CoA: 48.6
fatty_acid: 44.6
inactive: 36.1

ctg195_2: mmal

PKS_AT (593..891): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.8
Ethylmalonyl-CoA: 192.2
Methoxymalonyl-CoA: 173.2
2-Methylbutyryl-CoA: 133.7
trans-1,2-CPDA: 115.2
Propionyl-CoA: 108.6
Malonyl-CoA: 92.0
CHC-CoA: 90.0
Isobutyryl-CoA: 76.1
Benzoyl-CoA: 55.2
3-Methylbutyryl-CoA: 48.9
Acetyl-CoA: 38.8
fatty_acid: 36.8
inactive: 35.3

MUNE01000155.1 - Region 1 - T2PKS

Download region SVG

Location: 1 - 11,954 nt. (total: 11,954 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg200_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

ctg200_4: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg200_7: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: cyclase

ctg200_1: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

ctg200_10: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg200_9: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.75	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.65	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.59	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000271.5	0.54	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.52	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000197.5	0.52	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0001366.5	0.52	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.75	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.65	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.59	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000271.5	0.54	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.52	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000197.5	0.52	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0001366.5	0.52	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 11954
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 685.5; E-value: 4.7e-209)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: acetyl-CoA_8: 677 Da
acetyl-CoA_9: 719 Da

ctg200_1: CYC C7-C12 (Score: 378.5; E-value: 4.6e-116)
ctg200_10: KS (Score: 759.6; E-value: 1.8e-231)
ctg200_11: CYC C5-C14/C3-C16 (Score: 430.7; E-value: 4.4e-132)
ctg200_2: KR C9 (Score: 460.7; E-value: 3e-141)
ctg200_3: CYC C1-C18|C2-C19 (Score: 212.1; E-value: 6.3e-66)
ctg200_4: GT (Score: 379.0; E-value: 7.9e-116)
ctg200_7: GT (Score: 373.1; E-value: 4.8e-114)
ctg200_8: ACP (Score: 121.7; E-value: 2.2e-38)
ctg200_9: CLF 8|9 (Score: 685.5; E-value: 4.7e-209)

TFBS definitions

Regulator	Description

MUNE01000166.1 - Region 1 - RiPP-like,T1PKS

Download region SVG

Location: 1 - 23,558 nt. (total: 23,558 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg212_10: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

ctg212_16: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: ligase synthase

ctg212_13: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg212_14: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg212_15: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.44	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.41	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.41	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.31	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.30	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.30	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.29	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.29	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.29	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.27	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.72	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (1):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.93 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 23558:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg212_13: mal

PKS_AT (564..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 178.4
inactive: 101.2
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 64.9
Isobutyryl-CoA: 55.3
Propionyl-CoA: 47.6
Ethylmalonyl-CoA: 36.7
CHC-CoA: 31.1
Benzoyl-CoA: 29.8
2-Methylbutyryl-CoA: 29.4
Acetyl-CoA: 22.8
fatty_acid: 21.2
trans-1,2-CPDA: 19.6
3-Methylbutyryl-CoA: 9.5

ctg212_15: X

AMP-binding (17..424): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GFGCVGINTK
Nearest Stachelhaus code(s):: Val DFFCVGIVHK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

MUNE01000175.1 - Region 1 - terpene

Download region SVG

Location: 1 - 10,900 nt. (total: 10,900 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001684.3	0.36	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000572.5	0.36	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000571.3	0.35	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000500.5	0.34	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002116.3	0.32	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0002144.3	0.32	ribosomal	phazolicin	Rhizobium sp. Pop5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001684.3	0.36	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000572.5	0.36	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000571.3	0.35	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000500.5	0.34	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002116.3	0.32	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0002144.3	0.32	ribosomal	phazolicin	Rhizobium sp. Pop5

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

Additional weak hits (3):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

MUNE01000181.1 - Region 1 - transAT-PKS-like

Download region SVG

Location: 1 - 10,927 nt. (total: 10,927 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg229_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg229_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.57	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.57	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

Predicted core structure(s)

For candidate cluster 1, location 0 - 10927:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - redmal)

Direct lookup in NORINE database: strict or relaxed

MUNE01000185.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 17,933 nt. (total: 17,933 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg233_7: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

ctg233_9: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

ctg233_6: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.60	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.62 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.62 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 17933:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg233_7: pk

PKS_AT (566..863): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 66.7%; CE-Malonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 107.8
Malonyl-CoA: 102.3
Methoxymalonyl-CoA: 97.7
Ethylmalonyl-CoA: 75.5
Isobutyryl-CoA: 70.9
Propionyl-CoA: 60.9
2-Methylbutyryl-CoA: 49.6
Acetyl-CoA: 47.3
trans-1,2-CPDA: 42.6
fatty_acid: 41.6
CHC-CoA: 36.8
Benzoyl-CoA: 36.5
inactive: 28.5
3-Methylbutyryl-CoA: 23.7

TFBS definitions

Regulator	Description

MUNE01000186.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region SVG

Location: 1 - 27,734 nt. (total: 27,734 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg234_18: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase carbamoyltransferase

ctg234_10: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

ctg234_13: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deacetylase esterase

ctg234_24: thioesterase

smcogs: SMCOG1004: thioesterase

ctg234_26: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: lyase

ctg234_16: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: mutase

ctg234_9: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

ctg234_15: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

ctg234_19: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg234_21: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg234_23: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.24	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	1.03	NRPS	peramine	Epichloe festucae
BGC0001261.3	1.02	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.02	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.02	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.00	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.97	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.95	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.94	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.42 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.43 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.02 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.08 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.06 out of 24.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 27734:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (His)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 294 - 27734:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (His)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 3478 - 27734:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (His)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg234_19: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (0..367): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALWMGGVFK
Nearest Stachelhaus code(s):: Val DALWMGGVFK (59% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg234_21: mal

PKS_AT (538..816): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.2
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 49.8
CHC-CoA: 18.6
Ethylmalonyl-CoA: 16.8
Propionyl-CoA: 16.1
2-Methylbutyryl-CoA: 14.9
Isobutyryl-CoA: 12.3
inactive: 8.9
fatty_acid: 8.2
Benzoyl-CoA: 4.2
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg234_23: His

Search NORINE for peptide: strict or relaxed

AMP-binding (43..444): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSALIAEVWK
Nearest Stachelhaus code(s):: His DSALIAEVWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

MUNE01000198.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 33,868 nt. (total: 33,868 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg246_3: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg246_5: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: glycosyltransferase

ctg246_4: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: synthase

ctg246_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0000143.5	0.54	PKS	salinomycin	Streptomyces albus
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000138.5	0.49	PKS	rimocidin	Streptomyces diastaticus
BGC0002333.3	0.48	PKS	lucensomycin	Streptomyces cyanogenus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0000143.5	0.54	PKS	salinomycin	Streptomyces albus
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000138.5	0.49	PKS	rimocidin	Streptomyces diastaticus
BGC0002333.3	0.48	PKS	lucensomycin	Streptomyces cyanogenus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.76 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 33868:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - ohmal - ohmal - ohmal) + (ohmal - redmal)
Non-colinear ordering:: ctg246_1 + ctg246_5

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg246_1: mmal - mal - mal - mal

PKS_AT (263..561): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.7
Ethylmalonyl-CoA: 215.1
Methoxymalonyl-CoA: 183.0
2-Methylbutyryl-CoA: 139.7
trans-1,2-CPDA: 134.3
Propionyl-CoA: 111.2
CHC-CoA: 95.2
Malonyl-CoA: 89.6
Isobutyryl-CoA: 73.0
Benzoyl-CoA: 59.5
Acetyl-CoA: 47.4
fatty_acid: 37.8
3-Methylbutyryl-CoA: 34.6
inactive: 24.3

PKS_AT (1798..2094): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.0
inactive: 109.0
Methoxymalonyl-CoA: 60.5
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 20.3
Acetyl-CoA: 19.7
Isobutyryl-CoA: 17.7
Ethylmalonyl-CoA: 16.8
Benzoyl-CoA: 14.8
CHC-CoA: 11.0
fatty_acid: 9.9
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (3321..3619): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.7
inactive: 112.0
Methoxymalonyl-CoA: 76.9
Methylmalonyl-CoA: 67.9
Propionyl-CoA: 41.2
Isobutyryl-CoA: 35.5
Ethylmalonyl-CoA: 28.8
Benzoyl-CoA: 21.4
2-Methylbutyryl-CoA: 17.6
Acetyl-CoA: 16.7
CHC-CoA: 13.2
fatty_acid: 11.5
trans-1,2-CPDA: 8.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (4873..5170): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.4
inactive: 112.1
Methoxymalonyl-CoA: 67.9
Methylmalonyl-CoA: 61.0
Isobutyryl-CoA: 33.1
Propionyl-CoA: 26.6
Ethylmalonyl-CoA: 22.2
Benzoyl-CoA: 19.0
Acetyl-CoA: 17.6
CHC-CoA: 10.1
fatty_acid: 9.5
2-Methylbutyryl-CoA: 9.3
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

ctg246_5: mal - mal

PKS_AT (576..873): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.1
inactive: 100.8
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 61.1
Isobutyryl-CoA: 29.4
Acetyl-CoA: 29.2
Propionyl-CoA: 27.9
Ethylmalonyl-CoA: 22.5
trans-1,2-CPDA: 22.4
Benzoyl-CoA: 19.7
CHC-CoA: 8.5
2-Methylbutyryl-CoA: 5.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2093..2387): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.3
inactive: 115.6
Methoxymalonyl-CoA: 55.9
Methylmalonyl-CoA: 49.1
Isobutyryl-CoA: 32.9
Propionyl-CoA: 29.9
Acetyl-CoA: 29.5
Benzoyl-CoA: 14.2
fatty_acid: 12.2
2-Methylbutyryl-CoA: 7.7
Ethylmalonyl-CoA: 3.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description

MUNE01000199.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 22,538 nt. (total: 22,538 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase aminotransferase

ctg247_3: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg247_4: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg247_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 22538:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal) + (ohmal - ccmal)
Non-colinear ordering:: ctg247_4 + ctg247_2

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg247_2: mal - mal

PKS_AT (545..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.0
inactive: 101.2
Methoxymalonyl-CoA: 57.8
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 21.2
Isobutyryl-CoA: 20.0
Acetyl-CoA: 18.9
Benzoyl-CoA: 12.7
Ethylmalonyl-CoA: 12.3
fatty_acid: 10.2
CHC-CoA: 5.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2082..2381): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.5
inactive: 92.8
Methoxymalonyl-CoA: 79.5
Methylmalonyl-CoA: 76.2
Propionyl-CoA: 49.5
Isobutyryl-CoA: 40.7
Ethylmalonyl-CoA: 34.7
Acetyl-CoA: 28.6
2-Methylbutyryl-CoA: 25.7
CHC-CoA: 17.3
Benzoyl-CoA: 16.1
trans-1,2-CPDA: 15.9
fatty_acid: 14.7
3-Methylbutyryl-CoA: 0.0

ctg247_4: mal - mal

PKS_AT (603..894): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.1
inactive: 105.3
Methoxymalonyl-CoA: 69.0
Methylmalonyl-CoA: 59.4
Isobutyryl-CoA: 36.1
Propionyl-CoA: 30.7
Benzoyl-CoA: 20.2
Ethylmalonyl-CoA: 19.5
2-Methylbutyryl-CoA: 19.1
Acetyl-CoA: 17.6
fatty_acid: 8.8
trans-1,2-CPDA: 8.7
CHC-CoA: 6.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (1617..1912): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.4
inactive: 90.0
Methoxymalonyl-CoA: 76.2
Methylmalonyl-CoA: 70.6
Isobutyryl-CoA: 46.1
Ethylmalonyl-CoA: 40.4
Propionyl-CoA: 31.1
Acetyl-CoA: 20.4
CHC-CoA: 20.0
Benzoyl-CoA: 17.0
trans-1,2-CPDA: 14.9
fatty_acid: 12.0
3-Methylbutyryl-CoA: 10.0
2-Methylbutyryl-CoA: 7.8

MUNE01000200.1 - Region 1 - T1PKS

Download region SVG

Location: 2,037 - 33,186 nt. (total: 31,150 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg250_18: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg250_3: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

ctg250_10: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

ctg250_17: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002240.3	0.47	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000996.5	0.47	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000143.5	0.46	PKS	salinomycin	Streptomyces albus
BGC0001043.4	0.44	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.44	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000122.5	0.43	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001037.5	0.43	NRPS, PKS	pseurotin, azaspirene	Aspergillus fumigatus Af293

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002240.3	0.47	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000996.5	0.47	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0000143.5	0.46	PKS	salinomycin	Streptomyces albus
BGC0001043.4	0.44	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.44	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000122.5	0.43	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001037.5	0.43	NRPS, PKS	pseurotin, azaspirene	Aspergillus fumigatus Af293

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.27 out of 23.79

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.13 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 2036 - 33186:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg250_3: mal - mal

PKS_AT (22..311): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 34.6
inactive: 21.1
Methylmalonyl-CoA: 17.0
Methoxymalonyl-CoA: 16.6
Propionyl-CoA: 16.4
Isobutyryl-CoA: 11.9
2-Methylbutyryl-CoA: 8.6
Benzoyl-CoA: 8.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (345..622): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 110.3
Methoxymalonyl-CoA: 51.8
Methylmalonyl-CoA: 47.8
inactive: 32.4
2-Methylbutyryl-CoA: 30.8
Propionyl-CoA: 29.2
fatty_acid: 25.4
CHC-CoA: 20.3
Isobutyryl-CoA: 14.8
Ethylmalonyl-CoA: 13.7
trans-1,2-CPDA: 11.4
Acetyl-CoA: 11.1
Benzoyl-CoA: 10.2
3-Methylbutyryl-CoA: 0.0

ctg250_18: mal - mal

PKS_AT (587..894): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.3
inactive: 86.8
Methoxymalonyl-CoA: 66.0
Methylmalonyl-CoA: 62.5
Propionyl-CoA: 42.7
Ethylmalonyl-CoA: 38.9
2-Methylbutyryl-CoA: 26.5
Isobutyryl-CoA: 26.4
Benzoyl-CoA: 25.2
Acetyl-CoA: 19.8
trans-1,2-CPDA: 18.1
CHC-CoA: 16.2
fatty_acid: 11.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2404..2703): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 234.2
inactive: 115.4
Methoxymalonyl-CoA: 70.1
Methylmalonyl-CoA: 55.6
Isobutyryl-CoA: 31.3
Propionyl-CoA: 23.7
Ethylmalonyl-CoA: 22.9
Benzoyl-CoA: 21.5
Acetyl-CoA: 21.1
2-Methylbutyryl-CoA: 15.6
CHC-CoA: 12.7
fatty_acid: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000212.1 - Region 1 - NI-siderophore

Download region SVG

Location: 5,863 - 25,341 nt. (total: 19,479 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg262_10: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: decarboxylase

ctg262_19: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.67	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000947.5	0.53	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.48	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000943.5	0.46	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.39	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002694.2	0.37	other (other)	roseobactin	Phaeobacter inhibens 2.10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.67	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000947.5	0.53	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.48	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000943.5	0.46	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.39	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002694.2	0.37	other (other)	roseobactin	Phaeobacter inhibens 2.10

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 25.84 out of 26.33

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.24 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.75 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.85 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.62 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DmdR1	Iron(II)-dependent repressor

MUNE01000215.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 14,564 nt. (total: 14,564 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg264_12: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.20 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 14564:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg264_12: Leu - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (8..407): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWLVGAVIK
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1131..1530): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFWGVVYK
Nearest Stachelhaus code(s):: Leu DAYFWGVTFK (79% 8Å match); Val DAYFWGVTFK (76% 8Å match); Ile or Val DAYFWGVTFK (76% 8Å match); Ile DAYFWGVTFK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

MUNE01000226.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 30,412 nt. (total: 30,412 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg276_12: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg276_3: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg276_6: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Hydrolases: esterase

ctg276_13: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

ctg276_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg276_10: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg276_2: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

ctg276_5: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.65	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0000107.3	0.65	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.65	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0000107.3	0.65	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.51 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.25 out of 32.93

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 30412:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (emal - ccemal - Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg276_2: emal - emal - mmal

PKS_AT (561..859): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 195.4
Methylmalonyl-CoA: 189.7
Methoxymalonyl-CoA: 153.6
2-Methylbutyryl-CoA: 122.8
trans-1,2-CPDA: 112.2
Propionyl-CoA: 107.2
Isobutyryl-CoA: 88.6
CHC-CoA: 82.8
Malonyl-CoA: 74.8
Benzoyl-CoA: 58.3
Acetyl-CoA: 51.9
fatty_acid: 46.5
3-Methylbutyryl-CoA: 45.3
inactive: 29.8

PKS_AT (1588..1886): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 205.4
Methylmalonyl-CoA: 198.1
Methoxymalonyl-CoA: 159.0
2-Methylbutyryl-CoA: 132.2
trans-1,2-CPDA: 114.5
Propionyl-CoA: 109.3
Malonyl-CoA: 90.0
Isobutyryl-CoA: 89.3
CHC-CoA: 85.7
Benzoyl-CoA: 62.8
Acetyl-CoA: 52.7
3-Methylbutyryl-CoA: 46.2
fatty_acid: 41.4
inactive: 30.6

PKS_AT (3358..3656): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.2
Ethylmalonyl-CoA: 199.6
Methoxymalonyl-CoA: 178.7
2-Methylbutyryl-CoA: 145.2
trans-1,2-CPDA: 125.2
Propionyl-CoA: 119.8
Malonyl-CoA: 105.5
CHC-CoA: 94.4
Isobutyryl-CoA: 73.9
Benzoyl-CoA: 59.2
Acetyl-CoA: 54.7
fatty_acid: 51.8
3-Methylbutyryl-CoA: 44.1
inactive: 24.7

TFBS definitions

Regulator	Description

MUNE01000231.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 5,014 nt. (total: 5,014 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg282_1: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.49	PKS	curacin A	Moorea producens 19L
BGC0000353.5	0.47	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0002138.2	0.46	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001544.3	0.45	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001235.4	0.45	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.44	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000030.3	0.43	PKS	bikaverin	Fusarium fujikuroi IMI 58289

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000043.5	0.49	PKS	curacin A	Moorea producens 19L
BGC0000353.5	0.47	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0002138.2	0.46	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001544.3	0.45	NRPS, PKS	chlorflavonin	Aspergillus campestris IBT 28561
BGC0001235.4	0.45	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.44	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000030.3	0.43	PKS	bikaverin	Fusarium fujikuroi IMI 58289

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.00 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 5014:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg282_1: mal

PKS_AT (124..427): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.4
inactive: 104.9
Methoxymalonyl-CoA: 71.2
Methylmalonyl-CoA: 58.7
Propionyl-CoA: 41.8
Isobutyryl-CoA: 33.6
2-Methylbutyryl-CoA: 25.4
Ethylmalonyl-CoA: 17.3
Benzoyl-CoA: 16.5
CHC-CoA: 14.5
Acetyl-CoA: 11.9
3-Methylbutyryl-CoA: 11.5
fatty_acid: 9.4
trans-1,2-CPDA: 0.0

TFBS definitions

Regulator	Description

MUNE01000237.1 - Region 1 - NRPS-like,ranthipeptide

Download region SVG

Location: 1 - 22,596 nt. (total: 22,596 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg287_17: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: dehydratase

ctg287_16: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

ctg287_15: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.63	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.62	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.61	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001758.4	0.54	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.54	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.53	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002306.2	0.36	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000601.4	0.36	ribosomal	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000340.5	0.36	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000575.5	0.32	ribosomal	lariatin	Rhodococcus jostii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.64	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000340.5	0.50	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0002306.2	0.50	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000601.4	0.50	ribosomal	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000575.5	0.47	ribosomal	lariatin	Rhodococcus jostii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.61 out of 25.31

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.05 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.88 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.95 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 22596:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg287_15: X

AMP-binding (1..389): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IAEFIGAAGK
Nearest Stachelhaus code(s):: Ppa VALFIGAAGK (74% 8Å match); 4-ohPpa IAAFLGAAGK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 89; Score: 45.1

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor

MUNE01000024.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 8,785 nt. (total: 8,785 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg290_3: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 8785:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg290_3: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (1045..1447): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLVDK
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

MUNE01000243.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 21,047 nt. (total: 21,047 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg294_4: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: halogenase

ctg294_5: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000028Halogenation (identity: 69.90%)
smcogs: SMCOG1119: halogenase

Ligases: synthase

ctg294_8: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg294_9: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

ctg294_2: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.50 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.45 out of 27.78

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 21047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg294_8: mal

PKS_AT (1452..1738): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.0
inactive: 63.4
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 49.3
Ethylmalonyl-CoA: 22.6
2-Methylbutyryl-CoA: 21.4
Propionyl-CoA: 20.7
Isobutyryl-CoA: 17.7
Acetyl-CoA: 15.4
fatty_acid: 13.1
CHC-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Benzoyl-CoA: -1.7

ctg294_9: mmal

PKS_AT (561..850): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 222.2
Ethylmalonyl-CoA: 221.9
Methoxymalonyl-CoA: 181.4
trans-1,2-CPDA: 151.2
2-Methylbutyryl-CoA: 151.1
Propionyl-CoA: 126.6
Malonyl-CoA: 119.6
CHC-CoA: 108.8
Benzoyl-CoA: 67.3
Isobutyryl-CoA: 62.6
Acetyl-CoA: 51.3
fatty_acid: 36.5
inactive: 32.8
3-Methylbutyryl-CoA: 31.8

TFBS definitions

Regulator	Description

MUNE01000249.1 - Region 1 - NRPS

Download region SVG

Location: 11,505 - 41,232 nt. (total: 29,728 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg300_30: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: amidase

ctg300_15: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

ctg300_28: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transport

ctg300_26: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.00 out of 29.72

Confidence: medium

Additional weak hits (2):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.66 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 11504 - 41232:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg300_28: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (428..808): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1477..1866): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWWVGLVGK
Nearest Stachelhaus code(s):: Leu DAWLVGAVYK (68% 8Å match); Trp DAWSVGSVCK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C

MUNE01000251.1 - Region 1 - T1PKS

Download region SVG

Location: 41,601 - 68,750 nt. (total: 27,150 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

ctg303_40: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

ctg303_46: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

ctg303_47: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acylase

ctg303_55: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

ctg303_52: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Isomerases: racemase

ctg303_45: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.97 out of 23.79

Confidence: medium

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.77 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.17 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.12 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.25 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 41600 - 68750:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg303_55: mmal

PKS_AT (589..887): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.9
Ethylmalonyl-CoA: 204.6
Methoxymalonyl-CoA: 176.4
trans-1,2-CPDA: 152.2
2-Methylbutyryl-CoA: 139.3
Malonyl-CoA: 119.1
Propionyl-CoA: 115.2
CHC-CoA: 96.1
Isobutyryl-CoA: 79.4
Benzoyl-CoA: 68.8
Acetyl-CoA: 43.0
inactive: 36.8
3-Methylbutyryl-CoA: 35.6
fatty_acid: 26.1

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000252.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 5,070 nt. (total: 5,070 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg304_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5070:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg304_1: mal

PKS_AT (1..163): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 104.9
inactive: 51.2
Methoxymalonyl-CoA: 26.5
Methylmalonyl-CoA: 16.9
Propionyl-CoA: 13.0
Isobutyryl-CoA: 7.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MUNE01000253.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 17,596 nt. (total: 17,596 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg305_1: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg305_2: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0001665.3	0.58	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001065.5	0.57	PKS	herboxidiene	Streptomyces chromofuscus
BGC0000103.5	0.56	PKS	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000147.5	0.56	PKS	soraphen A	Sorangium cellulosum
BGC0000157.5	0.54	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002808.2	0.54	PKS	N-coronafacoyl-L-isoleucine	Streptomyces scabiei 87.22
BGC0001012.3	0.54	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001495.3	0.51	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0000113.5	0.51	PKS	niddamycin	Streptomyces caelestis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0001665.3	0.58	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001065.5	0.57	PKS	herboxidiene	Streptomyces chromofuscus
BGC0000103.5	0.56	PKS	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000147.5	0.56	PKS	soraphen A	Sorangium cellulosum
BGC0000157.5	0.54	PKS	tautomycetin	Streptomyces sp. CK4412
BGC0002808.2	0.54	PKS	N-coronafacoyl-L-isoleucine	Streptomyces scabiei 87.22
BGC0001012.3	0.54	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001495.3	0.51	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0000113.5	0.51	PKS	niddamycin	Streptomyces caelestis

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 17596:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (redmal - Me-redmal)
Non-colinear ordering:: ctg305_1 + ctg305_2

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg305_1: mal

PKS_AT (1..164): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 108.2
inactive: 53.1
Methoxymalonyl-CoA: 33.1
Methylmalonyl-CoA: 15.6
Propionyl-CoA: 14.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg305_2: mal - mmal

PKS_AT (568..864): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 232.6
inactive: 96.2
Methoxymalonyl-CoA: 65.9
Methylmalonyl-CoA: 59.4
Propionyl-CoA: 36.1
Ethylmalonyl-CoA: 26.9
Acetyl-CoA: 25.9
Isobutyryl-CoA: 25.0
Benzoyl-CoA: 18.1
trans-1,2-CPDA: 10.3
fatty_acid: 10.0
2-Methylbutyryl-CoA: 9.7
CHC-CoA: 8.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2620..2918): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 225.5
Ethylmalonyl-CoA: 216.6
Methoxymalonyl-CoA: 182.9
2-Methylbutyryl-CoA: 141.4
trans-1,2-CPDA: 133.9
Propionyl-CoA: 114.9
CHC-CoA: 100.4
Malonyl-CoA: 85.5
Isobutyryl-CoA: 67.5
Benzoyl-CoA: 56.4
Acetyl-CoA: 42.6
fatty_acid: 37.9
3-Methylbutyryl-CoA: 29.7
inactive: 22.5

MUNE01000254.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 20,897 nt. (total: 20,897 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg306_19: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

ctg306_4: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg306_5: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase transferase

ctg306_11: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

ctg306_13: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

ctg306_8: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

ctg306_12: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg306_9: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

ctg306_7: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (1):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.04 out of 29.25

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 20897:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg306_7: mal

PKS_AT (567..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 238.8
inactive: 129.9
Methoxymalonyl-CoA: 65.4
Methylmalonyl-CoA: 60.1
Isobutyryl-CoA: 36.9
Propionyl-CoA: 36.8
Ethylmalonyl-CoA: 26.5
Benzoyl-CoA: 24.0
Acetyl-CoA: 20.0
2-Methylbutyryl-CoA: 16.3
trans-1,2-CPDA: 16.2
fatty_acid: 13.0
CHC-CoA: 7.1
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

MUNE01000255.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 9,122 nt. (total: 9,122 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg307_1: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

ctg307_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9122:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg307_2: mmal

PKS_AT (560..857): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.2
Ethylmalonyl-CoA: 211.8
Methoxymalonyl-CoA: 188.0
2-Methylbutyryl-CoA: 146.2
trans-1,2-CPDA: 134.1
CHC-CoA: 120.0
Malonyl-CoA: 113.6
Propionyl-CoA: 104.6
Isobutyryl-CoA: 91.2
Benzoyl-CoA: 78.7
3-Methylbutyryl-CoA: 53.3
Acetyl-CoA: 49.1
fatty_acid: 37.9
inactive: 30.5

MUNE01000256.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 10,874 nt. (total: 10,874 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg308_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg308_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.58 out of 29.25

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 10874:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg308_1: pk - mal

PKS_AT (360..659): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 227.9
Methylmalonyl-CoA: 225.6
Methoxymalonyl-CoA: 180.6
2-Methylbutyryl-CoA: 165.2
trans-1,2-CPDA: 131.8
CHC-CoA: 121.7
Propionyl-CoA: 118.4
Malonyl-CoA: 100.5
Isobutyryl-CoA: 76.1
Benzoyl-CoA: 59.1
fatty_acid: 40.5
Acetyl-CoA: 39.6
3-Methylbutyryl-CoA: 38.2
inactive: 28.2

PKS_AT (1914..2209): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.5
inactive: 140.2
Methoxymalonyl-CoA: 59.6
Methylmalonyl-CoA: 53.1
Isobutyryl-CoA: 42.0
Propionyl-CoA: 29.1
Benzoyl-CoA: 26.0
Ethylmalonyl-CoA: 25.4
2-Methylbutyryl-CoA: 17.8
Acetyl-CoA: 16.4
trans-1,2-CPDA: 9.3
fatty_acid: 8.6
CHC-CoA: 7.9
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description

MUNE01000261.1 - Region 1 - RRE-containing,thioamitides

Download region SVG

Location: 1 - 15,398 nt. (total: 15,398 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03604) and TfuA)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg314_1: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: decarboxylase

ctg314_3: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

ctg314_2: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.34	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.28	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001146.5	0.27	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000625.5	0.23	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001696.5	0.22	ribosomal	neothioviridamide	Streptomyces sp.
BGC0002575.2	0.22	ribosomal	cochonodin I	Streptococcus suis
BGC0001802.5	0.21	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000603.5	0.21	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000043.5	0.21	PKS	curacin A	Moorea producens 19L
BGC0002669.2	0.20	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.49	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.45	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001146.5	0.42	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001696.5	0.39	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.39	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000943.5	0.38	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000603.5	0.38	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002575.2	0.37	ribosomal	cochonodin I	Streptococcus suis

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.02 out of 24.78

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 3 - 84; Score: 54.7; RRE type: Heterocycloanthracin_C_RRE; Location: 4 - 93; Score: 34.5
: RRE type: Thiopeptide_F_RRE; Location: 3 - 84; Score: 54.7; RRE type: Heterocycloanthracin_C_RRE; Location: 4 - 93; Score: 34.5

TFBS definitions

Regulator	Description

MUNE01000273.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 8,409 nt. (total: 8,409 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

ctg327_1: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.91 out of 30.25

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 8409:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg327_1: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (510..909): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

MUNE01000028.1 - Region 1 - butyrolactone

Download region SVG

Location: 1 - 6,570 nt. (total: 6,570 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

ctg333_3: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.57	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001458.4	0.31	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002657.2	0.25	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000877.5	0.25	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001771.4	0.24	NRPS	scleric acid	Streptomyces sclerotialus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.57	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.33	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001458.4	0.31	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002657.2	0.25	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000877.5	0.25	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001771.4	0.24	NRPS	scleric acid	Streptomyces sclerotialus

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.86 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

MUNE01000284.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 9,235 nt. (total: 9,235 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

ctg338_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg338_3: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.91 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 9235:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg338_1: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (440..829): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

MUNE01000286.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 23,169 nt. (total: 23,169 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg340_10: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

ctg340_8: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

ctg340_9: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase

ctg340_11: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

ctg340_4: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (1):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 23169:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (emal - pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg340_11: emal - pk

PKS_AT (0..170): emal

ATSignature: (unknown)

No matches above 50%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 78.7
Methylmalonyl-CoA: 71.1
Methoxymalonyl-CoA: 58.8
2-Methylbutyryl-CoA: 57.5
Isobutyryl-CoA: 45.7
Propionyl-CoA: 43.6
Malonyl-CoA: 37.7
trans-1,2-CPDA: 36.1
CHC-CoA: 29.0
3-Methylbutyryl-CoA: 25.3
Acetyl-CoA: 24.4
Benzoyl-CoA: 19.5
fatty_acid: 15.0
inactive: 0.0

PKS_AT (888..1188): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 218.7
Methylmalonyl-CoA: 213.8
Methoxymalonyl-CoA: 181.6
2-Methylbutyryl-CoA: 151.8
trans-1,2-CPDA: 132.2
Propionyl-CoA: 123.2
CHC-CoA: 116.6
Malonyl-CoA: 107.1
Isobutyryl-CoA: 85.5
Benzoyl-CoA: 64.6
Acetyl-CoA: 56.6
fatty_acid: 50.3
3-Methylbutyryl-CoA: 32.5
inactive: 31.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

MUNE01000030.1 - Region 1 - terpene

Download region SVG

Location: 1,595 - 33,588 nt. (total: 31,994 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg355_10: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

ctg355_28: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: aminotransferase methyltransferase

ctg355_19: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

ctg355_20: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

ctg355_22: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

ctg355_16: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.51	terpene	astallatene	Arabidopsis thaliana
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002400.2	0.48	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002007.2	0.48	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000675.5	0.46	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000678.5	0.46	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002557.2	0.45	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.44	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.51	terpene	astallatene	Arabidopsis thaliana
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002400.2	0.48	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002007.2	0.48	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000675.5	0.46	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000678.5	0.46	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002557.2	0.45	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.44	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

ctg355_16: PT_FPPS_like

Domain 1 (1 - 211): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

ctg355_26: T2TS

Domain 1 (4 - 625): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.98 out of 20.97

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.39 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.58 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

MUNE01000306.1 - Region 1 - terpene-precursor

Download region SVG

Location: 1 - 15,131 nt. (total: 15,131 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

ctg362_5: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002015.4	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001674.5	0.33	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.33	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.33	ribosomal	humidimycin	Streptomyces humidus
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.33	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002351.3	0.32	NRPS	thanafactin A	Pseudomonas sp. SHC52
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002015.4	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001674.5	0.33	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.33	ribosomal	siamycin I	Streptomyces sp.
BGC0002307.3	0.33	ribosomal	humidimycin	Streptomyces humidus
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000666.5	0.33	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002351.3	0.32	NRPS	thanafactin A	Pseudomonas sp. SHC52
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg362_5: PT_FPPS_like

Domain 1 (42 - 338): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.84 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.35 out of 23.79

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.36 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.84 out of 32.93

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.44 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

MUNE01000313.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 1 - 24,277 nt. (total: 24,277 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: peptidase

ctg370_22: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase dehydratase

ctg370_12: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

ctg370_13: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0000543.5	0.47	ribosomal	pep5	Staphylococcus epidermidis
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.48	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0000543.5	0.47	ribosomal	pep5	Staphylococcus epidermidis
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.16 out of 26.33

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.22 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.78 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.02 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 140 - 223; Score: 61.5

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

MUNE01000318.1 - Region 1 - hydrogen-cyanide

Download region SVG

Location: 13,678 - 26,661 nt. (total: 12,984 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

ctg375_16: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

ctg375_18: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Hydrolases: peptidase

ctg375_22: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.39	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002436.2	0.36	other (other)	coformycin	Streptomyces citricolor
BGC0000873.3	0.30	other (other)	A-201A	Saccharothrix mutabilis subsp. capreolus
BGC0001007.5	0.28	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.27	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001433.5	0.24	PKS	argimycin PI, argimycin PII, nigrifactin, argimycin PIV, argimycin PV, argimycin PVI, argimycin PIX	Streptomyces argillaceus
BGC0001205.3	0.23	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum
BGC0002498.3	0.21	other (other)	desulfoclethramycin, clethramycin	Streptomyces sp.
BGC0000440.5	0.21	NRPS	Teicoplanin A2-1, Teicoplanin A2-2, Teicoplanin A2-3, Teicoplanin A2-4, Teicoplanin A2-5	Actinoplanes teichomyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.39	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002436.2	0.36	other (other)	coformycin	Streptomyces citricolor
BGC0000873.3	0.30	other (other)	A-201A	Saccharothrix mutabilis subsp. capreolus
BGC0001007.5	0.28	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.27	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001433.5	0.24	PKS	argimycin PI, argimycin PII, nigrifactin, argimycin PIV, argimycin PV, argimycin PVI, argimycin PIX	Streptomyces argillaceus
BGC0001205.3	0.23	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum
BGC0002498.3	0.21	other (other)	desulfoclethramycin, clethramycin	Streptomyces sp.
BGC0000440.5	0.21	NRPS	Teicoplanin A2-1, Teicoplanin A2-2, Teicoplanin A2-3, Teicoplanin A2-4, Teicoplanin A2-5	Actinoplanes teichomyceticus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.47 out of 27.55

Confidence: medium

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.72 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes

MUNE01000318.1 - Region 2 - NRPS-like,T1PKS

Download region SVG

Location: 39,479 - 76,709 nt. (total: 37,231 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg375_36: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: formyltransferase methyltransferase sulfotransferase

ctg375_39: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

ctg375_40: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

ctg375_55: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Lyases: dehydratase lyase

ctg375_45: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

ctg375_54: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg375_34: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg375_48: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

ctg375_49: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg375_50: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.83	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.83	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002458.3	0.63	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.58	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002458.3	0.65	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.94 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 39478 - 76709:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg375_34: X

AMP-binding (26..438): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -LVVVGVGHK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg375_49: X

AMP-binding (25..431): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GMSYHGSGCK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg375_50: Leu - mmal

Search NORINE for peptide: strict or relaxed

AMP-binding (13..423): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LFLFRAHGLK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1169..1458): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 174.9
Ethylmalonyl-CoA: 142.8
Methoxymalonyl-CoA: 140.2
Malonyl-CoA: 105.0
2-Methylbutyryl-CoA: 92.0
Propionyl-CoA: 85.8
CHC-CoA: 83.6
trans-1,2-CPDA: 81.3
Isobutyryl-CoA: 78.9
fatty_acid: 42.7
inactive: 36.0
3-Methylbutyryl-CoA: 30.2
Acetyl-CoA: 29.9
Benzoyl-CoA: 29.6

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

MUNE01000331.1 - Region 1 - T2PKS

Download region SVG

Location: 1 - 12,059 nt. (total: 12,059 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg390_4: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: transferase

ctg390_12: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: cyclase

ctg390_10: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

ctg390_11: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

ctg390_7: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg390_8: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.72	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000271.5	0.71	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.56	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001366.5	0.54	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000204.5	0.53	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.72	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000271.5	0.71	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.56	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001366.5	0.54	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000204.5	0.53	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 12059
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

ctg390_10: CYC C9-C14 (Score: 244.6; E-value: 7.2e-76)
ctg390_11: CYC C4-C21/C2-C23|C2-C19 (Score: 145.7; E-value: 1e-45)
ctg390_4: OXY (Score: 294.8; E-value: 2.9e-90)
ctg390_6: CYC C5-C18 (Score: 217.3; E-value: 1.2e-67)
ctg390_7: KS (Score: 698.8; E-value: 5.3e-213)
ctg390_8: CLF (Score: 546.4; E-value: 8.8e-167)
ctg390_9: ACP (Score: 63.6; E-value: 2.9e-20)

TFBS definitions

Regulator	Description

MUNE01000337.1 - Region 1 - lanthipeptide-class-ii

BGC0001229.4 (SBI_06990):

Download region SVG

Location: 1 - 19,761 nt. (total: 19,761 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg396_11: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg396_13: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: methyltransferase

ctg396_9: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

ctg396_10: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

ctg396_7: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001229.4	1.00	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002110.3	0.63	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000520.5	0.56	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000555.3	0.51	ribosomal	staphylococcin C55 α, staphylococcin C55 β	Staphylococcus aureus
BGC0000623.3	0.49	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.47	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001391.3	0.47	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000552.3	0.46	ribosomal	SmbA, SmbB	Streptococcus mutans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001229.4	1.00	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0002110.3	0.63	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000520.5	0.56	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000555.3	0.51	ribosomal	staphylococcin C55 α, staphylococcin C55 β	Staphylococcus aureus
BGC0000623.3	0.49	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.4	0.47	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001391.3	0.47	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000554.4	0.47	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000552.3	0.46	ribosomal	SmbA, SmbB	Streptococcus mutans

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg396_7

ctg396_5

Leader:

MHQEFEGDISLVEELAEQDLHDAAQHGGTISPIDTVKIIFRVSSHFG

Core:

GNGGFGLFCTLSKECQPNCN

Core with dehydrations:

GNGGFGLFCysDhbLDhaKECysQPNCysN

antiSMASH-DB 4.0 matches for ctg396_5

100.0%

NC_016582.1and 1 other:

NC_016582.1 Lanthipeptides: SBI_RS34375_lanthipeptide

Lanthipeptides: SBI_RS34375_lanthipeptide

1

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

1

GNGGFGLFCTLSKECQPNCN

20

48.3%

NZ_CP034118.1and 1 other:

NZ_CP034118.1 Lanthipeptides: EG886_RS06305_lanthipeptide

Lanthipeptides: EG886_RS06305_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+KECQPNCN

11

GNTGRFCTLTKECQPNCN

28

45.8%

NZ_LT630004.1:

Lanthipeptides: BQ5796_RS17475_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+ EC P+CN

7

GNDGKFCTLTVECMPSCN

24

with 113 more sequence matches

Only the first 10 are displayed here.

44.8%

NZ_CP034118.1and 1 other:

NZ_CP034118.1 Lanthipeptides: EG886_RS06310_lanthipeptide

Lanthipeptides: EG886_RS06310_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+KECQP+CN

11

GNTGQFCTLTKECQPSCN

28

43.5%

NZ_CP050134.2and 3 others:

NZ_EQ973330.1 Lanthipeptides: CORMATOL_RS10565_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptide

Lanthipeptides: HBA49_RS00770_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CT++KEC P+CN

6

GNNGRWCTITKECMPSCN

23

43.3%

NZ_AKXV01000031.1and 8 others:

NZ_AKXV01000031.1 Lanthipeptides: Y19_RS0109895_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_JABBGE010000004.1 Lanthipeptides: HHL19_RS13545_lanthipeptideNZ_LMEI01000006.1 Lanthipeptides: ASC82_RS06140_lanthipeptideNZ_LMEI01000006.1 Lanthipeptides: ASC82_RS06140_lanthipeptide

Lanthipeptides: Y19_RS0109895_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNQGGWCTLTKECQPNCN

30

43.3%

NZ_BNBV01000031.1and 1 other:

NZ_BNBV01000031.1 Lanthipeptides: IE286_RS22995_lanthipeptide

Lanthipeptides: IE286_RS22995_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNSGGWCTLTKECQPNCN

30

43.3%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: IE314_RS15865_lanthipeptide

Lanthipeptides: IE314_RS15865_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNHGGWCTLTKECQPNCN

30

42.3%

NZ_LR134483.1and 1 other:

NZ_LR134483.1 Lanthipeptides: EL241_RS01720_lanthipeptide

Lanthipeptides: EL241_RS01720_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G CTL+KECQ CN

9

GNKGRICTLTKECQSMCN

26

40.9%

NZ_CP061033.1and 1 other:

NZ_CP061033.1 Lanthipeptides: IAU67_RS09320_lanthipeptide

Lanthipeptides: IAU67_RS09320_lanthipeptide

3

GGFGLFCTLSKECQPNC

19

G G FCT + ECQ C

5

GNEGNFCTGTIECQKTC

21

40.7%

NZ_CP022163.1:

Lanthipeptides: MEBOL_RS24465_lanthipeptide

1

GNGGFGLFCTLSKECQPNC

19

GN G G CT S EC+P C

9

GNSG-GWICTYSTECKPFC

26

40.7%

NZ_CP025249.1and 1 other:

NZ_CP025249.1 Lanthipeptides: CWT12_RS00385_lanthipeptide

Lanthipeptides: CWT12_RS00385_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G CTL+KECQ CN

10

GNTGYVCTLTKECQRMCN

27

40.0%

NZ_BJTV01000004.1and 1 other:

NZ_BJTV01000004.1 Lanthipeptides: TNCT1_RS10200_lanthipeptide

Lanthipeptides: TNCT1_RS10200_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQ NCN

13

GNHGGWCTLTKECQANCN

30

MIBiG 4.0 matches for ctg396_5

51.3%

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

39

43.3%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNNGGWCTLTKECQPNCN

30

35.7%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+ EC P+CN

11

GNKGAYCTLTVECMPSCN

28

ctg396_6

Leader:

MQKDTDILGA

Core:

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

Core with dehydrations:

WDEAELVELDhaEADVHGGDhbDPAVDhbGLILGIVAIQAGVAVGVDhaAAFCysPDhbDhbKCysDhbDhaRCys

antiSMASH-DB 4.0 matches for ctg396_6

100.0%

NC_016582.1and 1 other:

NC_016582.1 Lanthipeptides: SBI_RS34370_lanthipeptide

Lanthipeptides: SBI_RS34370_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

55.6%

NZ_BNBV01000031.1and 3 others:

NZ_BNBV01000031.1 Lanthipeptides: IE286_RS22985_lanthipeptideNZ_BNBV01000031.1 Lanthipeptides: IE286_RS22990_lanthipeptideNZ_BNBV01000031.1 Lanthipeptides: IE286_RS22985_lanthipeptide

Lanthipeptides: IE286_RS22990_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P + V V SAAFCPTTKCT+ C

1

YDEAELIELSEADVTGGTTP-----------VSIAVTVAASAAFCPTTKCTNDC

43

53.7%

NZ_AKXV01000031.1and 1 other:

NZ_AKXV01000031.1 Lanthipeptides: Y19_RS44045_lanthipeptide

Lanthipeptides: Y19_RS44045_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE ELVE+ EADV+GGT + AI VA VSA+ CPTTKCTS+C

1

YDEFELVEMGEADVYGGTTWSC--------AIVTAVATLVSASACPTTKCTSQC

46

with 108 more sequence matches

Only the first 10 are displayed here.

53.7%

NZ_BJTV01000004.1and 1 other:

NZ_BJTV01000004.1 Lanthipeptides: TNCT1_RS35805_lanthipeptide

Lanthipeptides: TNCT1_RS35805_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P + V V S AFCPT KCTS C

1

YDEAELIELSEADVTGGTTP-----------VSIAVTVAASVAFCPTIKCTSAC

43

53.7%

NZ_CP016795.1and 7 others:

NZ_CP016795.1 Lanthipeptides: BC342_RS37680_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS18955_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS18955_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS17685_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS17685_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS01490_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS01490_lanthipeptide

Lanthipeptides: BC342_RS37680_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P V+V S AFCPTTKCT C

1

YDEAELIELSEADVTGGTTPVS-----------VAVSVAASVAFCPTTKCTKEC

43

53.7%

NZ_KL997439.1and 1 other:

NZ_KL997439.1 Lanthipeptides: IQ62_RS33140_lanthipeptide

Lanthipeptides: IQ62_RS33140_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD HGGT P + V + VSA CPTTKCTS C

1

YDEAELIELSEADTHGGTGP----WCIATVTL-------VSAVACPTTKCTSSC

43

51.9%

NZ_CP107567.1and 3 others:

NZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptide

Lanthipeptides: OGH68_RS19755_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD +GGT + V + VSAA CPTTKCTS C

1

YDEAELIELSEADTYGGT----AAWCIATVTL-------VSAAMCPTTKCTSAC

43

51.9%

NZ_GG657757.1and 1 other:

NZ_GG657757.1 Lanthipeptides: SSQG_RS41860_lanthipeptide

Lanthipeptides: SSQG_RS41860_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD HGGT P + V + V+A CPTTKCTS+C

1

YDEAELIELSEADNHGGTGP----WCIATVTL-------VTATVCPTTKCTSKC

43

50.0%

NZ_QLLX01000002.1and 1 other:

NZ_QLLX01000002.1 Lanthipeptides: K378_RS30040_lanthipeptide

Lanthipeptides: K378_RS30040_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAELVELS+AD +GGT P + V + +AA CPTTKCTS+C

1

YDEAELVELSDADTYGGTGP----WCIATVTL-------ATAAICPTTKCTSQC

43

48.1%

NZ_BMMP01000005.1and 3 others:

NZ_BMMP01000005.1 Lanthipeptides: IEY56_RS09415_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptide

Lanthipeptides: IEY56_RS09415_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAELVELS+AD +GGT + L +AA CPTTKCTS+C

1

YDEAELVELSDADAYGGTAWVCATVTLA------------TAAICPTTKCTSQC

42

48.1%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: IE314_RS15870_lanthipeptide

Lanthipeptides: IE314_RS15870_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE EL+EL E HGGT V +V VS AFCPTTKCTS+C

1

YDELELIELGEDVAHGGTTSPVC----------IATSVAVSTAFCPTTKCTSKC

44

46.3%

NZ_JAASAG010000001.1and 1 other:

NZ_JAASAG010000001.1 Lanthipeptides: HCC61_RS01465_lanthipeptide

Lanthipeptides: HCC61_RS01465_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE ELVELS+AD +GGT P + +AA CPTTKCTS+C

1

YDEDELVELSDADTYGGTGPWCVATV-----------TLATAAICPTTKCTSQC

43

42.6%

NC_006322.1and 7 others:

NC_006322.1 Lanthipeptides: BLI_RS20290_lanthipeptideNZ_CP033218.1 Lanthipeptides: D9Y32_RS07810_lanthipeptideNZ_CP033218.1 Lanthipeptides: D9Y32_RS07810_lanthipeptideNZ_LQYL01000021.1 Lanthipeptides: B4090_RS08830_lanthipeptideNZ_LQYL01000021.1 Lanthipeptides: B4090_RS08830_lanthipeptideNZ_NIMP01000036.1 Lanthipeptides: CHCC14566_RS11870_lanthipeptideNZ_NIMP01000036.1 Lanthipeptides: CHCC14566_RS11870_lanthipeptide

Lanthipeptides: BLI_RS20290_lanthipeptide

13

DVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

DV+ T PA T I AGV V SA+ CPTTKCTSRC

2

DVNPETTPATTS---SWTCITAGVTV--SASLCPTTKCTSRC

38

MIBiG 4.0 matches for ctg396_6

68.5%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

18

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

1

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

37

18.5%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

44

FCPTTKCTSRC

54

FCPTTKCTS+C

16

FCPTTKCTSKC

26

Lanthipeptide(s) for ctg396_8

ctg396_5

Leader:

MHQEFEGDISLVEELAEQDLHDAAQHGGTISPIDTVKIIFRVSSHFG

Core:

GNGGFGLFCTLSKECQPNCN

Core with dehydrations:

GNGGFGLFCysDhbLDhaKECysQPNCysN

antiSMASH-DB 4.0 matches for ctg396_5

100.0%

NC_016582.1and 1 other:

NC_016582.1 Lanthipeptides: SBI_RS34375_lanthipeptide

Lanthipeptides: SBI_RS34375_lanthipeptide

1

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

1

GNGGFGLFCTLSKECQPNCN

20

48.3%

NZ_CP034118.1and 1 other:

NZ_CP034118.1 Lanthipeptides: EG886_RS06305_lanthipeptide

Lanthipeptides: EG886_RS06305_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+KECQPNCN

11

GNTGRFCTLTKECQPNCN

28

45.8%

NZ_LT630004.1:

Lanthipeptides: BQ5796_RS17475_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+ EC P+CN

7

GNDGKFCTLTVECMPSCN

24

with 113 more sequence matches

Only the first 10 are displayed here.

44.8%

NZ_CP034118.1and 1 other:

NZ_CP034118.1 Lanthipeptides: EG886_RS06310_lanthipeptide

Lanthipeptides: EG886_RS06310_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G FCTL+KECQP+CN

11

GNTGQFCTLTKECQPSCN

28

43.5%

NZ_CP050134.2and 3 others:

NZ_EQ973330.1 Lanthipeptides: CORMATOL_RS10565_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptide

Lanthipeptides: HBA49_RS00770_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CT++KEC P+CN

6

GNNGRWCTITKECMPSCN

23

43.3%

NZ_AKXV01000031.1and 8 others:

NZ_AKXV01000031.1 Lanthipeptides: Y19_RS0109895_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19760_lanthipeptideNZ_JABBGE010000004.1 Lanthipeptides: HHL19_RS13545_lanthipeptideNZ_LMEI01000006.1 Lanthipeptides: ASC82_RS06140_lanthipeptideNZ_LMEI01000006.1 Lanthipeptides: ASC82_RS06140_lanthipeptide

Lanthipeptides: Y19_RS0109895_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNQGGWCTLTKECQPNCN

30

43.3%

NZ_BNBV01000031.1and 1 other:

NZ_BNBV01000031.1 Lanthipeptides: IE286_RS22995_lanthipeptide

Lanthipeptides: IE286_RS22995_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNSGGWCTLTKECQPNCN

30

43.3%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: IE314_RS15865_lanthipeptide

Lanthipeptides: IE314_RS15865_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNHGGWCTLTKECQPNCN

30

42.3%

NZ_LR134483.1and 1 other:

NZ_LR134483.1 Lanthipeptides: EL241_RS01720_lanthipeptide

Lanthipeptides: EL241_RS01720_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G CTL+KECQ CN

9

GNKGRICTLTKECQSMCN

26

40.9%

NZ_CP061033.1and 1 other:

NZ_CP061033.1 Lanthipeptides: IAU67_RS09320_lanthipeptide

Lanthipeptides: IAU67_RS09320_lanthipeptide

3

GGFGLFCTLSKECQPNC

19

G G FCT + ECQ C

5

GNEGNFCTGTIECQKTC

21

40.7%

NZ_CP022163.1:

Lanthipeptides: MEBOL_RS24465_lanthipeptide

1

GNGGFGLFCTLSKECQPNC

19

GN G G CT S EC+P C

9

GNSG-GWICTYSTECKPFC

26

40.7%

NZ_CP025249.1and 1 other:

NZ_CP025249.1 Lanthipeptides: CWT12_RS00385_lanthipeptide

Lanthipeptides: CWT12_RS00385_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G CTL+KECQ CN

10

GNTGYVCTLTKECQRMCN

27

40.0%

NZ_BJTV01000004.1and 1 other:

NZ_BJTV01000004.1 Lanthipeptides: TNCT1_RS10200_lanthipeptide

Lanthipeptides: TNCT1_RS10200_lanthipeptide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQ NCN

13

GNHGGWCTLTKECQANCN

30

MIBiG 4.0 matches for ctg396_5

51.3%

BGC0001229.4 (SBI_06990):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

1

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

20

GNGGFGLFCTLSKECQPNCN

39

43.3%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+KECQPNCN

13

GNNGGWCTLTKECQPNCN

30

35.7%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

3

GGFGLFCTLSKECQPNCN

20

G G +CTL+ EC P+CN

11

GNKGAYCTLTVECMPSCN

28

ctg396_6

Leader:

MQKDTDILGA

Core:

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

Core with dehydrations:

WDEAELVELDhaEADVHGGDhbDPAVDhbGLILGIVAIQAGVAVGVDhaAAFCysPDhbDhbKCysDhbDhaRCys

antiSMASH-DB 4.0 matches for ctg396_6

100.0%

NC_016582.1and 1 other:

NC_016582.1 Lanthipeptides: SBI_RS34370_lanthipeptide

Lanthipeptides: SBI_RS34370_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

55.6%

NZ_BNBV01000031.1and 3 others:

NZ_BNBV01000031.1 Lanthipeptides: IE286_RS22985_lanthipeptideNZ_BNBV01000031.1 Lanthipeptides: IE286_RS22990_lanthipeptideNZ_BNBV01000031.1 Lanthipeptides: IE286_RS22985_lanthipeptide

Lanthipeptides: IE286_RS22990_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P + V V SAAFCPTTKCT+ C

1

YDEAELIELSEADVTGGTTP-----------VSIAVTVAASAAFCPTTKCTNDC

43

53.7%

NZ_AKXV01000031.1and 1 other:

NZ_AKXV01000031.1 Lanthipeptides: Y19_RS44045_lanthipeptide

Lanthipeptides: Y19_RS44045_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE ELVE+ EADV+GGT + AI VA VSA+ CPTTKCTS+C

1

YDEFELVEMGEADVYGGTTWSC--------AIVTAVATLVSASACPTTKCTSQC

46

with 108 more sequence matches

Only the first 10 are displayed here.

53.7%

NZ_BJTV01000004.1and 1 other:

NZ_BJTV01000004.1 Lanthipeptides: TNCT1_RS35805_lanthipeptide

Lanthipeptides: TNCT1_RS35805_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P + V V S AFCPT KCTS C

1

YDEAELIELSEADVTGGTTP-----------VSIAVTVAASVAFCPTIKCTSAC

43

53.7%

NZ_CP016795.1and 7 others:

NZ_CP016795.1 Lanthipeptides: BC342_RS37680_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS18955_lanthipeptideNZ_CP036534.1 Lanthipeptides: EZV63_RS18955_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS17685_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS17685_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS01490_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS01490_lanthipeptide

Lanthipeptides: BC342_RS37680_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEADV GGT P V+V S AFCPTTKCT C

1

YDEAELIELSEADVTGGTTPVS-----------VAVSVAASVAFCPTTKCTKEC

43

53.7%

NZ_KL997439.1and 1 other:

NZ_KL997439.1 Lanthipeptides: IQ62_RS33140_lanthipeptide

Lanthipeptides: IQ62_RS33140_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD HGGT P + V + VSA CPTTKCTS C

1

YDEAELIELSEADTHGGTGP----WCIATVTL-------VSAVACPTTKCTSSC

43

51.9%

NZ_CP107567.1and 3 others:

NZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptideNZ_CP107567.1 Lanthipeptides: OGH68_RS19755_lanthipeptide

Lanthipeptides: OGH68_RS19755_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD +GGT + V + VSAA CPTTKCTS C

1

YDEAELIELSEADTYGGT----AAWCIATVTL-------VSAAMCPTTKCTSAC

43

51.9%

NZ_GG657757.1and 1 other:

NZ_GG657757.1 Lanthipeptides: SSQG_RS41860_lanthipeptide

Lanthipeptides: SSQG_RS41860_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAEL+ELSEAD HGGT P + V + V+A CPTTKCTS+C

1

YDEAELIELSEADNHGGTGP----WCIATVTL-------VTATVCPTTKCTSKC

43

50.0%

NZ_QLLX01000002.1and 1 other:

NZ_QLLX01000002.1 Lanthipeptides: K378_RS30040_lanthipeptide

Lanthipeptides: K378_RS30040_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAELVELS+AD +GGT P + V + +AA CPTTKCTS+C

1

YDEAELVELSDADTYGGTGP----WCIATVTL-------ATAAICPTTKCTSQC

43

48.1%

NZ_BMMP01000005.1and 3 others:

NZ_BMMP01000005.1 Lanthipeptides: IEY56_RS09415_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptideNZ_FMHJ01000003.1 Lanthipeptides: H181DRAFT_RS29345_lanthipeptide

Lanthipeptides: IEY56_RS09415_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DEAELVELS+AD +GGT + L +AA CPTTKCTS+C

1

YDEAELVELSDADAYGGTAWVCATVTLA------------TAAICPTTKCTSQC

42

48.1%

NZ_BNCA01000011.1and 1 other:

NZ_BNCA01000011.1 Lanthipeptides: IE314_RS15870_lanthipeptide

Lanthipeptides: IE314_RS15870_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE EL+EL E HGGT V +V VS AFCPTTKCTS+C

1

YDELELIELGEDVAHGGTTSPVC----------IATSVAVSTAFCPTTKCTSKC

44

46.3%

NZ_JAASAG010000001.1and 1 other:

NZ_JAASAG010000001.1 Lanthipeptides: HCC61_RS01465_lanthipeptide

Lanthipeptides: HCC61_RS01465_lanthipeptide

1

WDEAELVELSEADVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

+DE ELVELS+AD +GGT P + +AA CPTTKCTS+C

1

YDEDELVELSDADTYGGTGPWCVATV-----------TLATAAICPTTKCTSQC

43

42.6%

NC_006322.1and 7 others:

NC_006322.1 Lanthipeptides: BLI_RS20290_lanthipeptideNZ_CP033218.1 Lanthipeptides: D9Y32_RS07810_lanthipeptideNZ_CP033218.1 Lanthipeptides: D9Y32_RS07810_lanthipeptideNZ_LQYL01000021.1 Lanthipeptides: B4090_RS08830_lanthipeptideNZ_LQYL01000021.1 Lanthipeptides: B4090_RS08830_lanthipeptideNZ_NIMP01000036.1 Lanthipeptides: CHCC14566_RS11870_lanthipeptideNZ_NIMP01000036.1 Lanthipeptides: CHCC14566_RS11870_lanthipeptide

Lanthipeptides: BLI_RS20290_lanthipeptide

13

DVHGGTDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

DV+ T PA T I AGV V SA+ CPTTKCTSRC

2

DVNPETTPATTS---SWTCITAGVTV--SASLCPTTKCTSRC

38

MIBiG 4.0 matches for ctg396_6

68.5%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

18

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

54

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

1

TDPAVTGLILGIVAIQAGVAVGVSAAFCPTTKCTSRC

37

18.5%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

44

FCPTTKCTSRC

54

FCPTTKCTS+C

16

FCPTTKCTSKC

26

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.83 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

ctg396_5 - Class II

Cleavage pHMM score: -3.50

RODEO score: 0

Monoisotopic mass: 2051.9 Da

Molecular weight: 2053.3 Da

Number of bridges: 2

ctg396_6 - Class II

Cleavage pHMM score: -1.00

RODEO score: 0

Monoisotopic mass: 5282.7 Da

Molecular weight: 5285.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5304.0 Da N = 1; 5322.0 Da N = 2; 5340.0 Da N = 3; 5358.0 Da N = 4; 5376.0 Da N = 5

ctg396_5 - Class II

Cleavage pHMM score: -3.50

RODEO score: 0

Monoisotopic mass: 2051.9 Da

Molecular weight: 2053.3 Da

Number of bridges: 2

ctg396_6 - Class II

Cleavage pHMM score: -1.00

RODEO score: 0

Monoisotopic mass: 5282.7 Da

Molecular weight: 5285.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5304.0 Da N = 1; 5322.0 Da N = 2; 5340.0 Da N = 3; 5358.0 Da N = 4; 5376.0 Da N = 5

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

MUNE01000346.1 - Region 1 - redox-cofactor

Download region SVG

Location: 11,190 - 26,408 nt. (total: 15,219 nt) Show pHMM detection rules used

Region on contig edge.

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg406_21: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.33	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002535.2	0.31	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002007.2	0.29	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000453.5	0.27	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0000344.5	0.21	NRPS	entolysin	Pseudomonas entomophila L48

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.33	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002535.2	0.31	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002007.2	0.29	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000453.5	0.27	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0000344.5	0.21	NRPS	entolysin	Pseudomonas entomophila L48

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.22 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 19 - 99; Score: 61.2

TFBS definitions

Regulator	Description

MUNE01000348.1 - Region 1 - RiPP-like

Download region SVG

Location: 1 - 7,392 nt. (total: 7,392 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0002713.2		0.20	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0002713.2		0.20	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.62 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.49 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description

MUNE01000035.1 - Region 1 - terpene

Download region SVG

Location: 24,844 - 39,194 nt. (total: 14,351 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg410_27: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg410_30: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

ctg410_38: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acylase

ctg410_31: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase synthetase

ctg410_26: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg410_29: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg410_39: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000663.5	0.57	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002711.2	0.49	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000663.5	0.57	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002711.2	0.49	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		hydroxysqualene	C30	acyclic	OH
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none

Genes with terpene domains:

ctg410_36: PT_phytoene_like

Domain 1 (1 - 265): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

ctg410_37: PT_phytoene_like

Domain 1 (17 - 310): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

ctg410_39: PT_FPPS_like

Domain 1 (68 - 278): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.30 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

MUNE01000354.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 13,183 nt. (total: 13,183 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase transferase

ctg415_2: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg415_5: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg415_7: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

ctg415_4: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg415_6: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

ctg415_8: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.06 out of 29.38

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 13183:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg415_8: mmal

PKS_AT (526..827): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 201.8
Ethylmalonyl-CoA: 190.3
Methoxymalonyl-CoA: 163.9
2-Methylbutyryl-CoA: 143.6
trans-1,2-CPDA: 125.1
Propionyl-CoA: 109.0
CHC-CoA: 83.6
Malonyl-CoA: 83.4
Isobutyryl-CoA: 79.8
Benzoyl-CoA: 56.1
Acetyl-CoA: 43.3
fatty_acid: 37.3
3-Methylbutyryl-CoA: 32.7
inactive: 25.4

TFBS definitions

Regulator	Description

MUNE01000356.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 13,594 nt. (total: 13,594 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg417_2: Heterocyclization, Hydroxylation

MITE: MITE0000010Heterocyclization, Hydroxylation (identity: 99.80%)
smcogs: SMCOG1034: cytochrome P450

ctg417_4: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

ctg417_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.33 out of 29.38

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 13594:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg417_1: mal

PKS_AT (1030..1316): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.1
inactive: 83.9
Methoxymalonyl-CoA: 55.2
Methylmalonyl-CoA: 47.5
Isobutyryl-CoA: 37.1
Ethylmalonyl-CoA: 24.7
Propionyl-CoA: 22.0
Acetyl-CoA: 19.6
Benzoyl-CoA: 17.5
CHC-CoA: 14.5
2-Methylbutyryl-CoA: 13.6
fatty_acid: 12.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description

MUNE01000357.1 - Region 1 - terpene

Download region SVG

Location: 1 - 12,053 nt. (total: 12,053 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg418_12: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acetyltransferase glycosyltransferase

ctg418_14: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

ctg418_9: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000236.5	0.35	PKS	kinamycin	Streptomyces murayamaensis
BGC0001687.3	0.31	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0000651.5	0.31	terpene	KS-505a	Streptomyces argenteolus
BGC0001707.5	0.31	ribosomal	nosiheptide	Streptomyces sp.
BGC0000611.5	0.28	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0000339.5	0.26	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001596.3	0.26	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000957.5	0.25	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000236.5	0.35	PKS	kinamycin	Streptomyces murayamaensis
BGC0001687.3	0.31	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0000651.5	0.31	terpene	KS-505a	Streptomyces argenteolus
BGC0001707.5	0.31	ribosomal	nosiheptide	Streptomyces sp.
BGC0000611.5	0.28	ribosomal	siomycin A	Streptomyces sioyaensis
BGC0000339.5	0.26	NRPS	echinomycin	Streptomyces lasaliensis
BGC0001596.3	0.26	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000957.5	0.25	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

ctg418_4: PT_phytoene_like

Domain 1 (18 - 260): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.93 out of 29.51

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.85 out of 30.22

Confidence: medium

Additional weak hits (1):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
DosR	Hypoxia stress response regulator

MUNE01000366.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 25,057 nt. (total: 25,057 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg428_9: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000043.5	0.43	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.42	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000160.3	0.42	PKS	terreic acid	Aspergillus terreus NIH2624
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000041.3	0.39	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000043.5	0.43	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.42	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000160.3	0.42	PKS	terreic acid	Aspergillus terreus NIH2624
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000041.3	0.39	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.87 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 25057:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg428_9: mal - mal - mal

PKS_AT (156..450): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.4
inactive: 106.6
Methoxymalonyl-CoA: 70.8
Methylmalonyl-CoA: 58.6
Propionyl-CoA: 30.8
Isobutyryl-CoA: 26.1
Ethylmalonyl-CoA: 25.6
Benzoyl-CoA: 23.2
CHC-CoA: 22.0
2-Methylbutyryl-CoA: 19.0
Acetyl-CoA: 18.6
fatty_acid: 13.3
trans-1,2-CPDA: 12.1
3-Methylbutyryl-CoA: 6.0

PKS_AT (1911..2201): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.8
inactive: 118.6
Methoxymalonyl-CoA: 71.6
Methylmalonyl-CoA: 65.3
Propionyl-CoA: 30.4
Isobutyryl-CoA: 26.7
Benzoyl-CoA: 23.3
Ethylmalonyl-CoA: 23.1
Acetyl-CoA: 20.5
2-Methylbutyryl-CoA: 18.2
CHC-CoA: 18.0
fatty_acid: 16.5
3-Methylbutyryl-CoA: 13.9
trans-1,2-CPDA: 11.0

PKS_AT (3679..3961): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.9
inactive: 84.2
Methoxymalonyl-CoA: 67.6
Methylmalonyl-CoA: 62.8
Propionyl-CoA: 38.6
Ethylmalonyl-CoA: 32.6
2-Methylbutyryl-CoA: 28.9
CHC-CoA: 24.2
Acetyl-CoA: 21.1
Benzoyl-CoA: 18.4
trans-1,2-CPDA: 17.1
Isobutyryl-CoA: 15.2
fatty_acid: 14.5
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

MUNE01000367.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 24,225 nt. (total: 24,225 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase

ctg429_12: aminotransferase

smcogs: SMCOG1019: aminotransferase

ctg429_13: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

ctg429_2: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg429_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (3):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.66 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.95 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.46 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 24225:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Phe - D-Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg429_2: X

AMP-binding (20..430): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AYYTSAHGMK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg429_4: Phe - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (511..909): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DSWVMVGICK
Nearest Stachelhaus code(s):: Trp DAWVMTGVGK (62% 8Å match); Phe DAWVLAGIQK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (2063..2480): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match); Val DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

MUNE01000386.1 - Region 1 - terpene-precursor

Download region SVG

Location: 1,874 - 22,833 nt. (total: 20,960 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

ctg448_15: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

ctg448_16: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg448_9: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Ligases: synthetase

ctg448_13: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000678.5	0.43	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg448_13: PT_FPPS_like

Domain 1 (22 - 310): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

Additional weak hits (7):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.00 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.21 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.55 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.61 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.24 out of 27.55

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
VqsM	Regulator of quorum-sensing signalling systems

MUNE01000401.1 - Region 1 - NRPS-like,T1PKS

Download region SVG

Location: 1 - 6,171 nt. (total: 6,171 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg466_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002171.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.61	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6171:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg466_1: AHBA - mal

CAL_domain (1..278): AHBA

minowa: AHBA

Prediction, score:

AHBA: 182.5
shikimic_acid: 129.0
NH2: 14.3
Acetyl-CoA: 9.9
fatty_acid: 0.0

PKS_AT (1030..1339): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.7
inactive: 90.8
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 51.2
Isobutyryl-CoA: 24.2
Ethylmalonyl-CoA: 23.3
Benzoyl-CoA: 19.8
fatty_acid: 13.4
Acetyl-CoA: 13.4
CHC-CoA: 10.9
2-Methylbutyryl-CoA: 7.5
Propionyl-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

MUNE01000402.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 7,763 nt. (total: 7,763 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg467_4: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7763:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg467_4: mmal - mmal

PKS_AT (102..400): mmal

ATSignature: 2-Methylbutyryl-CoA

Top 3 matches:: 2-Methylbutyryl-CoA: 70.8%; Methylmalonyl-CoA: 62.5%; Isobutyryl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 155.4
Ethylmalonyl-CoA: 154.2
2-Methylbutyryl-CoA: 140.5
Methoxymalonyl-CoA: 131.1
trans-1,2-CPDA: 115.8
Propionyl-CoA: 98.3
CHC-CoA: 93.7
Malonyl-CoA: 62.8
Acetyl-CoA: 57.7
Benzoyl-CoA: 53.6
Isobutyryl-CoA: 52.7
3-Methylbutyryl-CoA: 22.7
fatty_acid: 15.8
inactive: 9.4

PKS_AT (1123..1378): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 167.1
Methoxymalonyl-CoA: 141.6
Ethylmalonyl-CoA: 128.0
2-Methylbutyryl-CoA: 115.8
Propionyl-CoA: 93.1
trans-1,2-CPDA: 84.9
CHC-CoA: 81.1
Malonyl-CoA: 70.0
Benzoyl-CoA: 45.4
Isobutyryl-CoA: 41.3
Acetyl-CoA: 28.0
inactive: 21.7
fatty_acid: 19.6
3-Methylbutyryl-CoA: 17.1

MUNE01000404.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 3,518 nt. (total: 3,518 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg469_1: mmal

PKS_AT (930..1172): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 160.0
Ethylmalonyl-CoA: 152.5
Methoxymalonyl-CoA: 143.8
2-Methylbutyryl-CoA: 100.1
Propionyl-CoA: 98.9
trans-1,2-CPDA: 95.6
CHC-CoA: 80.4
Malonyl-CoA: 74.4
Isobutyryl-CoA: 55.5
Benzoyl-CoA: 45.9
inactive: 32.5
Acetyl-CoA: 23.3
fatty_acid: 22.5
3-Methylbutyryl-CoA: 13.5

MUNE01000411.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 5,280 nt. (total: 5,280 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg476_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5280:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg476_1: mal

PKS_AT (499..787): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 238.9
inactive: 137.4
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 54.5
Propionyl-CoA: 34.1
Isobutyryl-CoA: 31.6
Benzoyl-CoA: 24.7
Ethylmalonyl-CoA: 24.3
2-Methylbutyryl-CoA: 16.3
Acetyl-CoA: 16.2
trans-1,2-CPDA: 12.8
fatty_acid: 8.4
CHC-CoA: 4.7
3-Methylbutyryl-CoA: 0.0

MUNE01000416.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 4,333 nt. (total: 4,333 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg481_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.27 out of 23.79

Confidence: medium

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 4333:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg481_3: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (453..881): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000422.1 - Region 1 - PKS-like

Download region SVG

Location: 1 - 5,813 nt. (total: 5,813 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg487_4: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase synthase

ctg487_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg487_5: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (2):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.96 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.81 out of 20.01

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg487_3: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (8..391): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLFYVAWVCK
Nearest Stachelhaus code(s):: Pro DLFYVAWVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

MUNE01000427.1 - Region 1 - terpene

Download region SVG

Location: 1,614 - 19,423 nt. (total: 17,810 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Oxidation dehydrogenase oxygenase

ctg492_11: Dehydration, Oxidation

MITE: MITE0000058Dehydration, Oxidation (identity: 89.00%)
smcogs: SMCOG1121: dioxygenase, TauD/TfdA

ctg492_12: Oxidation

MITE: MITE0000057Oxidation (identity: 92.20%)

ctg492_13: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg492_2: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg492_3: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

ctg492_8: Oxidation

MITE: MITE0000060Oxidation (identity: 93.20%)
smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase oxygenase

ctg492_11: Dehydration, Oxidation

MITE: MITE0000058Dehydration, Oxidation (identity: 89.00%)
smcogs: SMCOG1121: dioxygenase, TauD/TfdA

ctg492_9: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

ctg492_10: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.77	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000678.5	0.68	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000653.5	0.63	terpene	pentalenolactone	Streptomyces arenae
BGC0002162.3	0.57	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000677.5	0.53	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000667.3	0.51	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001911.3	0.50	terpene	raimonol	Streptomyces anulatus
BGC0000674.5	0.50	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.77	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000678.5	0.68	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000653.5	0.63	terpene	pentalenolactone	Streptomyces arenae
BGC0002162.3	0.57	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000677.5	0.53	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000667.3	0.51	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001911.3	0.50	terpene	raimonol	Streptomyces anulatus
BGC0000674.5	0.50	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

ctg492_9: T1TS

Domain 1 (2 - 315): Type 1 terpene synthase

Subtype: unknown

ctg492_10: PT_FPPS_like

Domain 1 (52 - 326): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.05 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.25 out of 35.63

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

MUNE01000430.1 - Region 1 - transAT-PKS-like

Download region SVG

Location: 1 - 4,581 nt. (total: 4,581 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg495_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000056.3	0.54	PKS	esperamicin	Actinomadura verrucosospora
BGC0000107.3	0.53	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.53	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000056.3	0.54	PKS	esperamicin	Actinomadura verrucosospora
BGC0000107.3	0.53	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.53	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

MUNE01000442.1 - Region 1 - RiPP-like

Download region SVG

Location: 6,733 - 17,683 nt. (total: 10,951 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.47	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.47	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.16 out of 27.04

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.16 out of 29.51

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

Additional weak hits (5):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.41 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.49 out of 33.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DosR	Hypoxia stress response regulator

MUNE01000443.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 16,351 nt. (total: 16,351 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg509_1: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

ctg509_2: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001235.4	0.49	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.46	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001235.4	0.49	NRPS, PKS	antalid	Polyangium spumosum
BGC0002229.2	0.46	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.29 out of 26.85

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 16351:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg509_1: mmal - mmal

PKS_AT (652..948): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.5
Ethylmalonyl-CoA: 189.0
Methoxymalonyl-CoA: 171.5
2-Methylbutyryl-CoA: 119.1
trans-1,2-CPDA: 107.0
Propionyl-CoA: 99.1
Malonyl-CoA: 90.3
CHC-CoA: 84.1
Isobutyryl-CoA: 56.0
Benzoyl-CoA: 52.8
Acetyl-CoA: 45.7
3-Methylbutyryl-CoA: 37.0
inactive: 22.9
fatty_acid: 22.2

PKS_AT (2433..2730): mmal

ATSignature: Propionyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Propionyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%; Malonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.9
Methoxymalonyl-CoA: 164.4
Ethylmalonyl-CoA: 162.7
trans-1,2-CPDA: 113.1
2-Methylbutyryl-CoA: 110.7
Malonyl-CoA: 105.3
Propionyl-CoA: 90.0
Isobutyryl-CoA: 69.8
CHC-CoA: 69.2
Benzoyl-CoA: 57.5
3-Methylbutyryl-CoA: 53.5
Acetyl-CoA: 41.9
fatty_acid: 28.7
inactive: 23.7

ctg509_2: NH2

CAL_domain (30..480): NH2

minowa: NH2

Prediction, score:

NH2: 171.7
Acetyl-CoA: 44.0
fatty_acid: 4.8
AHBA: 3.0
shikimic_acid: 0.0

TFBS definitions

Regulator	Description

MUNE01000444.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 21,778 nt. (total: 21,778 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg510_10: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

ctg510_11: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: ligase

ctg510_15: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (1):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.39 out of 32.93

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 21778:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg510_15: X

AMP-binding (317..725): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMGEMGTIDK
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

MUNE01000455.1 - Region 1 - furan

Download region SVG

Location: 1 - 20,243 nt. (total: 20,243 nt) Show pHMM detection rules used

Region on contig edge.

furan: (mmyO or AvrD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg522_11: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase

ctg522_15: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg522_18: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002284.3	0.41	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000003.3	0.40	PKS	AF-toxin	Alternaria alternata
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002473.3	0.39	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000207.5	0.38	PKS	chartreusin	Streptomyces chartreusis
BGC0001463.4	0.38	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0001464.3	0.38	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0002147.2	0.37	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000914.5	0.36	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.42	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002284.3	0.41	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000003.3	0.40	PKS	AF-toxin	Alternaria alternata
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002473.3	0.39	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000207.5	0.38	PKS	chartreusin	Streptomyces chartreusis
BGC0001463.4	0.38	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0001464.3	0.38	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0002147.2	0.37	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000914.5	0.36	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.49 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.61 out of 28.14

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

MUNE01000458.1 - Region 1 - RiPP-like

Download region SVG

Location: 12,962 - 19,219 nt. (total: 6,258 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

Additional weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.92 out of 29.65

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

MUNE01000465.1 - Region 1 - terpene

Download region SVG

Location: 1,357 - 20,601 nt. (total: 19,245 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

ctg533_13: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

ctg533_5: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

ctg533_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.80	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.77	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002135.2	0.56	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.80	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.77	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002135.2	0.56	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene			C15	C1-C11	none

Genes with terpene domains:

ctg533_13: T1TS

Domain 1 (26 - 352): Type 1 terpene synthase

Subtype: Isoafricanol synthase type

Reactions:: FPP → sesquiterpene_C1-C11

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.89 out of 27.04

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

MUNE01000476.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 12,715 nt. (total: 12,715 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg544_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 12715:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Phe - D-Phe)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg544_1: Phe - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (13..231): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1282..1681): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: DSWLTAAVCK
Nearest Stachelhaus code(s):: His DSELTAEVCK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

MUNE01000483.1 - Region 1 - hglE-KS

Download region SVG

Location: 1 - 6,769 nt. (total: 6,769 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg552_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg552_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000863.3	0.54	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000056.3	0.52	PKS	esperamicin	Actinomadura verrucosospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000863.3	0.54	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000056.3	0.52	PKS	esperamicin	Actinomadura verrucosospora

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg552_1: mal

PKS_AT (679..973): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 82.5
inactive: 33.7
Methoxymalonyl-CoA: 32.4
Methylmalonyl-CoA: 27.3
Propionyl-CoA: 7.0
CHC-CoA: 3.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MUNE01000513.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 5,463 nt. (total: 5,463 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg586_1: mal

PKS_AT (1386..1680): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.9
inactive: 78.6
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 59.2
Isobutyryl-CoA: 36.9
fatty_acid: 36.8
Propionyl-CoA: 24.3
Ethylmalonyl-CoA: 23.4
trans-1,2-CPDA: 21.1
Acetyl-CoA: 18.2
2-Methylbutyryl-CoA: 13.5
CHC-CoA: 12.3
Benzoyl-CoA: 10.7
3-Methylbutyryl-CoA: 0.0

MUNE01000517.1 - Region 1 - HR-T2PKS,NRPS

Download region SVG

Location: 1 - 7,999 nt. (total: 7,999 nt) Show pHMM detection rules used

Region on contig edge.

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg589_4: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: esterase

ctg589_2: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

ctg589_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg589_6: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000553.1 - Region 1 - NRPS-like

Download region SVG

Location: 1 - 9,761 nt. (total: 9,761 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg625_7: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Lyases: dehydratase

ctg625_5: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

ctg625_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.65	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000340.5	0.54	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001844.4	0.46	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001873.3	0.46	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001668.4	0.44	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0002348.2	0.43	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0000393.5	0.41	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.65	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000340.5	0.54	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001844.4	0.46	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001873.3	0.46	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001668.4	0.44	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0002348.2	0.43	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0000393.5	0.41	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.73 out of 23.79

Confidence: strong

Additional weak hits (1):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.76 out of 26.85

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 9761:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg625_4: X

AMP-binding (35..432): X

nrpys: Ppa

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VALFVGAAGK
Nearest Stachelhaus code(s):: Ppa VALFVGAAGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000568.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 13,463 nt. (total: 13,463 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

ctg639_2: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Ligases: ligase

ctg639_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg639_5: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.96 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 13463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Pro) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg639_4: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (491..888): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: DGHFLGGVYK
Nearest Stachelhaus code(s):: Ile or Val DGFFLGVVYK (59% 8Å match); Ile DGFFLGVVYK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg639_5: X - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (20..435): X

nrpys: Ile, Val, Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGATFK
Nearest Stachelhaus code(s):: Ile DAFFLGITFK (88% 8Å match); Leu or Ile DAFFLGMTFK (62% 8Å match); Val DAFWLGATFK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1083..1494): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

MUNE01000569.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 8,586 nt. (total: 8,586 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg640_5: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg640_4: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000037.4	0.57	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002175.3	0.57	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000037.4	0.57	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002175.3	0.57	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.51 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.70 out of 26.06

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg640_5: mmal

PKS_AT (556..876): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 134.9
Ethylmalonyl-CoA: 116.7
Methoxymalonyl-CoA: 111.1
Malonyl-CoA: 90.0
Isobutyryl-CoA: 84.9
2-Methylbutyryl-CoA: 81.5
Propionyl-CoA: 77.8
trans-1,2-CPDA: 67.4
Acetyl-CoA: 58.9
fatty_acid: 38.6
3-Methylbutyryl-CoA: 37.1
CHC-CoA: 35.1
inactive: 32.4
Benzoyl-CoA: 20.2

TFBS definitions

Regulator	Description

MUNE01000594.1 - Region 1 - RiPP-like

Download region SVG

Location: 1 - 1,248 nt. (total: 1,248 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.41	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.40	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000613.5	0.36	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001860.4	0.36	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001753.3	0.35	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000193.3	0.35	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000612.4	0.35	ribosomal	thiocillin I	Bacillus cereus ATCC 14579

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.41	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.40	ribosomal	kocurin	Kocuria rosea
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000613.5	0.36	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001860.4	0.36	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001753.3	0.35	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000193.3	0.35	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000612.4	0.35	ribosomal	thiocillin I	Bacillus cereus ATCC 14579

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

MUNE01000613.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 8,997 nt. (total: 8,997 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg682_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

ctg682_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000143.5	0.61	PKS	salinomycin	Streptomyces albus
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000143.5	0.61	PKS	salinomycin	Streptomyces albus
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 8997:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (ohmal)
Non-colinear ordering:: ctg682_2 + ctg682_1

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg682_1: mal

PKS_AT (567..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.7
inactive: 142.9
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 56.1
Propionyl-CoA: 32.2
Isobutyryl-CoA: 30.9
Ethylmalonyl-CoA: 27.2
Benzoyl-CoA: 26.2
2-Methylbutyryl-CoA: 17.2
Acetyl-CoA: 16.2
trans-1,2-CPDA: 11.9
fatty_acid: 8.8
CHC-CoA: 6.5
3-Methylbutyryl-CoA: 0.0

ctg682_2: mal

PKS_AT (14..309): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 228.1
inactive: 136.8
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 49.9
Isobutyryl-CoA: 37.2
Propionyl-CoA: 26.2
Ethylmalonyl-CoA: 24.4
Benzoyl-CoA: 22.5
Acetyl-CoA: 14.8
2-Methylbutyryl-CoA: 14.8
trans-1,2-CPDA: 8.6
fatty_acid: 8.6
CHC-CoA: 7.8
3-Methylbutyryl-CoA: 0.0

MUNE01000617.1 - Region 1 - thioamitides

Download region SVG

Location: 1 - 3,598 nt. (total: 3,598 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.50	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.44	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001696.5	0.41	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.41	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000565.5	0.32	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002120.3	0.31	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001471.5	0.30	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001474.4	0.26	ribosomal	thiopeptin	Streptomyces tateyamensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.50	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.44	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001696.5	0.41	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.41	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000565.5	0.32	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002120.3	0.31	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001471.5	0.30	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001474.4	0.26	ribosomal	thiopeptin	Streptomyces tateyamensis

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

MUNE01000625.1 - Region 1 - NRPS,transAT-PKS-like

Download region SVG

Location: 1 - 6,052 nt. (total: 6,052 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg695_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.58	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.58	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.58	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.57	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.56	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg695_1: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (508..898): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01000627.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 3,964 nt. (total: 3,964 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg697_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg697_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 3964:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hpg)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg697_1: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (55..460): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYHLGLLCK
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01000628.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 6,766 nt. (total: 6,766 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg698_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg698_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6766:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg698_1: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (145..517): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYELGLLCK
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

ctg698_2: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (597..994): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: DVFSVACVYK
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUNE01000629.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 5,387 nt. (total: 5,387 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg699_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg699_2: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5387:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg699_1: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (0..257): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg699_2: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (463..851): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: DAYHLGLLCK
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01000633.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 2,226 nt. (total: 2,226 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg704_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.57	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002171.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002175.3	0.57	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002171.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.57	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg704_1: mal

PKS_AT (542..742): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.5
inactive: 48.1
Methoxymalonyl-CoA: 43.9
Methylmalonyl-CoA: 33.5
Ethylmalonyl-CoA: 23.7
Acetyl-CoA: 22.5
Isobutyryl-CoA: 18.4
Benzoyl-CoA: 16.0
Propionyl-CoA: 14.9
fatty_acid: 14.5
2-Methylbutyryl-CoA: 10.6
trans-1,2-CPDA: 8.9
CHC-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

MUNE01000634.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 3,076 nt. (total: 3,076 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg705_1: mal

PKS_AT (825..1025): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.9
inactive: 47.8
Methoxymalonyl-CoA: 46.7
Methylmalonyl-CoA: 36.8
Ethylmalonyl-CoA: 24.9
Acetyl-CoA: 23.0
Isobutyryl-CoA: 17.1
Propionyl-CoA: 15.2
fatty_acid: 13.4
CHC-CoA: 12.2
2-Methylbutyryl-CoA: 11.9
Benzoyl-CoA: 11.8
trans-1,2-CPDA: 9.2
3-Methylbutyryl-CoA: 0.0

MUNE01000064.1 - Region 1 - PKS-like

Download region SVG

Location: 1 - 13,785 nt. (total: 13,785 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg711_8: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase glycosyltransferase transferase

ctg711_13: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

ctg711_2: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

ctg711_6: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

ctg711_9: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

ctg711_10: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg711_12: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

ctg711_7: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

ctg711_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg711_5: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000749.3	0.53	saccharide	capsular polysaccharide	Escherichia coli
BGC0001817.5	0.53	other (other)	vancosamine	Streptomyces sp. WAC2288

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000749.3	0.53	saccharide	capsular polysaccharide	Escherichia coli
BGC0001817.5	0.53	other (other)	vancosamine	Streptomyces sp. WAC2288

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg711_4: X

AMP-binding (21..426): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DYYPTTMRIK
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (76% 8Å match); 3S-Abu DYYPTTQRIK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

MUNE01000643.1 - Region 1 - NRPS-like

Download region SVG

Location: 1 - 6,717 nt. (total: 6,717 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

ctg715_5: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.96 out of 36.54

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description

MUNE01000645.1 - Region 1 - NRPS,transAT-PKS-like

Download region SVG

Location: 1 - 7,500 nt. (total: 7,500 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg717_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.57	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.57	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.57	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.57	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7500:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg717_1: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (461..847): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01000646.1 - Region 1 - PKS-like,hglE-KS,transAT-PKS

Download region SVG

Location: 1 - 14,717 nt. (total: 14,717 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
hglE-KS: (hglE or hglD)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg718_3: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

ctg718_2: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

ctg718_7: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.93	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.90	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.89	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.87	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.87	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.86	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.86	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.85	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.43 out of 31.73

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

ctg718_7: mal

PKS_AT (575..877): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 86.9
Methoxymalonyl-CoA: 36.7
Methylmalonyl-CoA: 34.0
inactive: 30.1
fatty_acid: 22.6
Isobutyryl-CoA: 16.9
CHC-CoA: 12.2
Ethylmalonyl-CoA: 10.2
trans-1,2-CPDA: 0.0
Propionyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description

MUNE01000660.1 - Region 1 - arylpolyene

Download region SVG

Location: 1 - 13,506 nt. (total: 13,506 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

ctg734_14: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

ctg734_15: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

ctg734_7: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Ligases: synthase

ctg734_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

ctg734_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002171.2	0.43	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.43	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002510.2	0.41	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001075.5	0.41	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001909.3	0.41	PKS	strobilurin A	Strobilurus tenacellus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002171.2	0.43	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.43	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002510.2	0.41	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001075.5	0.41	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001909.3	0.41	PKS	strobilurin A	Strobilurus tenacellus

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.87 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.12 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 32.93

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

MUNE01000665.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 2,751 nt. (total: 2,751 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg739_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg739_1: mal

PKS_AT (500..789): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.4
inactive: 128.6
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 58.9
Isobutyryl-CoA: 41.7
Benzoyl-CoA: 30.6
Ethylmalonyl-CoA: 30.3
Propionyl-CoA: 29.6
Acetyl-CoA: 20.8
fatty_acid: 14.0
trans-1,2-CPDA: 11.5
2-Methylbutyryl-CoA: 10.6
CHC-CoA: 3.6
3-Methylbutyryl-CoA: 0.0

MUNE01000672.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region SVG

Location: 1 - 21,165 nt. (total: 21,165 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

ctg746_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg746_6: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	1.07	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	1.07	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.97	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.96	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.96	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.96	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.96	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.95	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.95	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.94	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

Additional weak hits (9):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.51 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.40 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.14 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.59 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.04 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.31 out of 29.38

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 21165:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - Pro) + (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg746_1: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (1..360): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match); Ala or Ser DVWHFSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

ctg746_6: X - mal - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (50..471): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GALWLGATAK
Nearest Stachelhaus code(s):: 2S-Hic GILWLGASGK (50% 8Å match); Val DALWLGGTFK (35% 8Å match); bOH-Val DALWLGGTFK (32% 8Å match)
Stachelhaus code match:: 70% (weak)

PKS_AT (1205..1489): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 58.3%; CE-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.2
Methylmalonyl-CoA: 47.0
inactive: 46.9
Methoxymalonyl-CoA: 46.5
Propionyl-CoA: 29.9
CHC-CoA: 24.7
fatty_acid: 20.3
trans-1,2-CPDA: 19.9
Benzoyl-CoA: 16.0
2-Methylbutyryl-CoA: 15.6
Ethylmalonyl-CoA: 14.9
Acetyl-CoA: 12.7
Isobutyryl-CoA: 11.5
3-Methylbutyryl-CoA: 0.0

AMP-binding (2516..2907): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFVAQIIK
Nearest Stachelhaus code(s):: Hpr DVQFVAQVVK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000721.1 - Region 1 - lanthipeptide-class-iii

Download region SVG

Location: 1 - 3,974 nt. (total: 3,974 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg795_2: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000553.3	0.47	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.46	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000551.5	0.44	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.43	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.43	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000496.5	0.42	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.39	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000553.3	0.47	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.46	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000551.5	0.44	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.43	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.43	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000496.5	0.42	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.39	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.52 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.07 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description

MUNE01000073.1 - Region 1 - T1PKS

Download region SVG

Location: 2,610 - 44,723 nt. (total: 42,114 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg801_22: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

ctg801_28: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acylase methyltransferase

ctg801_15: methyltransferase

smcogs: SMCOG1089: methyltransferase

ctg801_20: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase

ctg801_13: amidase

smcogs: SMCOG1105: amidase

Isomerases: racemase

ctg801_29: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

ctg801_19: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg801_21: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

ctg801_30: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.32 out of 23.79

Confidence: medium

Additional weak hits (5):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.35 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.56 out of 35.63

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 2609 - 44723:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal) + (Me-ccmal)
Non-colinear ordering:: ctg801_20 + ctg801_21

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg801_19: NH2

CAL_domain (149..469): NH2

minowa: NH2

Prediction, score:

NH2: 66.6
fatty_acid: 19.8
Acetyl-CoA: 17.2
shikimic_acid: 0.0
AHBA: 0.0

ctg801_20: mal - mal

PKS_AT (342..637): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 113.4
Methylmalonyl-CoA: 37.4
inactive: 37.2
Methoxymalonyl-CoA: 34.3
Propionyl-CoA: 16.8
Ethylmalonyl-CoA: 14.7
Acetyl-CoA: 13.5
Isobutyryl-CoA: 13.3
Benzoyl-CoA: 11.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1315..1601): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.7
inactive: 104.7
Methoxymalonyl-CoA: 67.3
Methylmalonyl-CoA: 46.4
Propionyl-CoA: 32.9
fatty_acid: 19.4
Isobutyryl-CoA: 18.6
Acetyl-CoA: 15.4
Ethylmalonyl-CoA: 15.1
2-Methylbutyryl-CoA: 12.0
Benzoyl-CoA: 10.4
CHC-CoA: 9.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg801_21: mmal

PKS_AT (534..825): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.5
Ethylmalonyl-CoA: 182.7
Methoxymalonyl-CoA: 163.9
2-Methylbutyryl-CoA: 136.9
trans-1,2-CPDA: 122.7
Propionyl-CoA: 97.2
Malonyl-CoA: 96.0
CHC-CoA: 89.4
Isobutyryl-CoA: 77.5
Benzoyl-CoA: 62.1
Acetyl-CoA: 33.5
fatty_acid: 29.1
inactive: 23.0
3-Methylbutyryl-CoA: 16.2

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

MUNE01000735.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 1,227 nt. (total: 1,227 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

ctg807_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg807_1: mal

PKS_AT (248..409): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 78.6
Methoxymalonyl-CoA: 33.2
inactive: 30.7
Methylmalonyl-CoA: 26.2
Acetyl-CoA: 21.7
Isobutyryl-CoA: 18.2
Ethylmalonyl-CoA: 17.0
fatty_acid: 15.9
Benzoyl-CoA: 12.6
2-Methylbutyryl-CoA: 10.8
Propionyl-CoA: 10.2
CHC-CoA: 9.8
trans-1,2-CPDA: 8.1
3-Methylbutyryl-CoA: 0.0

MUNE01000761.1 - Region 1 - terpene

Download region SVG

Location: 1 - 13,145 nt. (total: 13,145 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Terpene

Pfam domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg833_2: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: methyltransferase

ctg833_7: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

ctg833_8: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.86	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001972.4	0.40	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000468.5	0.35	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0002415.2	0.30	NRPS	vanchrobactin, trivanchrobactin, divanchrobactin	Vibrio campbellii
BGC0002666.2	0.30	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000466.5	0.27	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0001580.3	0.26	PKS	ebelactone	Kitasatospora aburaviensis
BGC0000451.5	0.26	NRPS	turnerbactin	Teredinibacter turnerae T7901

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.86	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001972.4	0.40	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000468.5	0.35	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0002415.2	0.30	NRPS	vanchrobactin, trivanchrobactin, divanchrobactin	Vibrio campbellii
BGC0002666.2	0.30	NRPS, other (other)	Legonmycin A, Legonmycin B, Legonindolizine A, Legonindolizine B	Streptomyces sp. MA37
BGC0000466.5	0.27	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0001580.3	0.26	PKS	ebelactone	Kitasatospora aburaviensis
BGC0000451.5	0.26	NRPS	turnerbactin	Teredinibacter turnerae T7901

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

ctg833_8: T1TS

Domain 1 (5 - 396): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Terpene

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

MUNE01000776.1 - Region 1 - NI-siderophore

Download region SVG

Location: 1 - 15,977 nt. (total: 15,977 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg847_10: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Isomerases: mutase

ctg847_11: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.49	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002692.2	0.43	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.41	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.40	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000295.5	0.39	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002683.2	0.37	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.36	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002527.2	0.36	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.36	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.49	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002692.2	0.43	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.41	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.40	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000295.5	0.39	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002683.2	0.37	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.36	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002527.2	0.36	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.36	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.60 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

Additional weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

MUNE01000809.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 7,777 nt. (total: 7,777 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg880_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg880_4: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7777:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg880_3: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (478..887): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKLAVVSK
Nearest Stachelhaus code(s):: Glu DLTKLAAVTK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

ctg880_4: X

AMP-binding (463..755): X

nrpys: (unknown)

SVM prediction details:

NOTE: uncertain match

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFW-GV--AK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

MUNE01000820.1 - Region 1 - NRPS,transAT-PKS-like

Download region SVG

Location: 1 - 7,727 nt. (total: 7,727 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg891_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7727:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg891_1: Thr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (873..1281): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1970..2376): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MUNE01000827.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 3,547 nt. (total: 3,547 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg897_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg897_2: mmal

PKS_AT (557..860): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.3
Ethylmalonyl-CoA: 203.5
Methoxymalonyl-CoA: 176.4
2-Methylbutyryl-CoA: 150.6
Propionyl-CoA: 144.7
trans-1,2-CPDA: 126.3
CHC-CoA: 112.1
Malonyl-CoA: 108.4
Isobutyryl-CoA: 69.3
Benzoyl-CoA: 61.0
Acetyl-CoA: 56.5
fatty_acid: 43.7
3-Methylbutyryl-CoA: 39.2
inactive: 27.9

MUNE01000828.1 - Region 1 - NRPS,T1PKS

Download region SVG

Location: 1 - 8,534 nt. (total: 8,534 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

ctg898_1: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

ctg898_2: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 8534:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg898_1: X

AMP-binding (246..631): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASVVGCVTK
Nearest Stachelhaus code(s):: OH-Orn DGEVVGGVTK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

ctg898_2: mal

PKS_AT (515..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.4
inactive: 35.7
Methoxymalonyl-CoA: 26.7
Methylmalonyl-CoA: 24.2
Propionyl-CoA: 12.4
Isobutyryl-CoA: 4.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MUNE01000829.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 1,533 nt. (total: 1,533 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg899_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0000037.4	0.55	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg899_1: mmal

PKS_AT (216..511): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.3
Ethylmalonyl-CoA: 207.2
Methoxymalonyl-CoA: 172.1
2-Methylbutyryl-CoA: 167.1
trans-1,2-CPDA: 135.3
Propionyl-CoA: 124.7
Malonyl-CoA: 116.3
CHC-CoA: 111.8
Isobutyryl-CoA: 95.2
Acetyl-CoA: 66.0
Benzoyl-CoA: 65.7
3-Methylbutyryl-CoA: 46.6
inactive: 39.1
fatty_acid: 37.8

MUNE01000830.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 1,803 nt. (total: 1,803 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg901_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.63	PKS	esperamicin	Actinomadura verrucosospora
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.63	PKS	esperamicin	Actinomadura verrucosospora
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg901_1: mmal

PKS_AT (246..541): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.6
Ethylmalonyl-CoA: 205.4
Methoxymalonyl-CoA: 172.3
2-Methylbutyryl-CoA: 167.0
trans-1,2-CPDA: 129.2
Propionyl-CoA: 124.5
Malonyl-CoA: 116.7
CHC-CoA: 109.5
Isobutyryl-CoA: 95.5
Benzoyl-CoA: 66.5
Acetyl-CoA: 65.2
3-Methylbutyryl-CoA: 52.9
inactive: 38.2
fatty_acid: 38.2

MUNE01000856.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 1,896 nt. (total: 1,896 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

ctg925_1: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

MUNE01000086.1 - Region 1 - NAPAA

Download region SVG

Location: 1 - 23,845 nt. (total: 23,845 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

ctg928_16: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

ctg928_2: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: deaminase esterase hydrolase

ctg928_1: isochorismatase

smcogs: SMCOG1027: isochorismatase

ctg928_15: thioesterase

smcogs: SMCOG1004: thioesterase

ctg928_17: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: synthase

ctg928_18: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: transporter

ctg928_4: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (6):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.83 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.22 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.84 out of 33.14

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 23845:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg928_15: X

AMP-binding (189..591): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIWQSTADDK
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (94% 8Å match); dnmeProp or Dab DIWQSTADDK (85% 8Å match); Asp DIWQSTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

MUNE01000866.1 - Region 1 - thioamitides

Download region SVG

Location: 1 - 3,537 nt. (total: 3,537 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

TIGRFAM domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

ctg935_4: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.54	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.40	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.36	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.36	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.35	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001474.4	0.33	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001471.5	0.32	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001473.4	0.31	ribosomal	Sch 18640	Micromonospora arborensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.54	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.40	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.36	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.36	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.35	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001474.4	0.33	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001471.5	0.32	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001473.4	0.31	ribosomal	Sch 18640	Micromonospora arborensis

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

MUNE01000868.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 3,232 nt. (total: 3,232 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters

No significant matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

ctg937_1: pk

PKS_AT (904..1075): pk

ATSignature: Methoxymalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 113.6
Methylmalonyl-CoA: 112.3
Methoxymalonyl-CoA: 96.5
2-Methylbutyryl-CoA: 91.9
trans-1,2-CPDA: 67.9
CHC-CoA: 65.9
Propionyl-CoA: 59.1
Malonyl-CoA: 57.2
Isobutyryl-CoA: 41.3
Benzoyl-CoA: 34.5
Acetyl-CoA: 25.0
3-Methylbutyryl-CoA: 18.1
fatty_acid: 13.5
inactive: 13.4

MUNE01000896.1 - Region 1 - isocyanide-nrp

Download region SVG

Location: 1 - 10,978 nt. (total: 10,978 nt) Show pHMM detection rules used

Region on contig edge.

isocyanide-nrp: (DIT1_PvcA and minimum(2, [AMP-binding, PP-binding, Transferase]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

ctg967_5: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

ctg967_3: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.60	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001748.4	0.44	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0001631.4	0.40	NRPS, PKS	kasumigamide	Microcystis aeruginosa NIES-87
BGC0002348.2	0.40	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0001630.4	0.38	NRPS, PKS	kasumigamide	uncultured Candidatus Entotheonella sp.
BGC0001341.4	0.36	NRPS	valinomycin	Rothia nasimurium
BGC0001029.5	0.36	NRPS, PKS	nostophycin	Nostoc sp. 152
BGC0000297.5	0.35	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126
BGC0001444.5	0.35	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.60	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001748.4	0.44	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0001631.4	0.40	NRPS, PKS	kasumigamide	Microcystis aeruginosa NIES-87
BGC0002348.2	0.40	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0001630.4	0.38	NRPS, PKS	kasumigamide	uncultured Candidatus Entotheonella sp.
BGC0001341.4	0.36	NRPS	valinomycin	Rothia nasimurium
BGC0001029.5	0.36	NRPS, PKS	nostophycin	Nostoc sp. 152
BGC0000297.5	0.35	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126
BGC0001444.5	0.35	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937

Similar known clusters

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 10978:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg967_3: X

AMP-binding (25..400): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGARHGIGRK
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

ctg967_5: NH2

CAL_domain (269..586): NH2

minowa: NH2

Prediction, score:

NH2: 10.2
shikimic_acid: 0.0
fatty_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

TFBS definitions

Regulator	Description

MUNE01000009.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 9,010 nt. (total: 9,010 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg970_1: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 9010:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg970_1: mmal

PKS_AT (585..885): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 195.6
Ethylmalonyl-CoA: 178.0
Methoxymalonyl-CoA: 154.4
2-Methylbutyryl-CoA: 128.2
trans-1,2-CPDA: 117.4
Propionyl-CoA: 101.9
Malonyl-CoA: 99.2
CHC-CoA: 86.5
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 59.9
Acetyl-CoA: 54.3
3-Methylbutyryl-CoA: 33.9
inactive: 29.4
fatty_acid: 23.2

TFBS definitions

Regulator	Description

MUNE01000091.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 29,001 nt. (total: 29,001 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

Pfam domains

TIGRFAM domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

ctg982_10: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: ligase synthase

ctg982_4: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

ctg982_5: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transport transporter

ctg982_17: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

ctg982_8: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001873.3	0.66	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001873.3	0.66	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.67 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.60 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.71 out of 27.04

Confidence: weak

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 29001:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Pro)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg982_4: Ser - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (299..709): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1371..1779): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFVSQVVK
Nearest Stachelhaus code(s):: Pro DVQFVAQVVK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description

MUNE01000914.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 5,688 nt. (total: 5,688 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

ClusterBlast

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

Pfam domains

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

ctg987_2: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

ctg987_1: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 5688:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

ctg987_2: mmal

PKS_AT (290..589): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.1
Ethylmalonyl-CoA: 213.9
Methoxymalonyl-CoA: 168.9
2-Methylbutyryl-CoA: 134.6
trans-1,2-CPDA: 125.7
CHC-CoA: 106.1
Propionyl-CoA: 105.2
Malonyl-CoA: 99.3
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 60.1
Acetyl-CoA: 51.6
fatty_acid: 36.8
3-Methylbutyryl-CoA: 34.2
inactive: 23.4

MUNE01000987.1 - Region 1 - NRPS